Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Macrophage migration inhibitory factor (MIF)

Recombinant Human Macrophage migration inhibitory factor (MIF) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: MIF. Target Synonyms: Glycosylation-inhibiting factor; GIFL-dopachrome isomeraseL-dopachrome tautomerase (EC:5.3.3.12) Phenylpyruvate tautomerase. Accession Number: P14174. Expression Region: 2~115aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 16.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Macrophage migration inhibitory factor (MIF) is a purified Recombinant Protein.

Accession Number

P14174

Expression Region

2~115aa

Host

E. coli

Target

MIF

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Field of Research

Immunology

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

16.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Glycosylation-inhibiting factor; GIFL-dopachrome isomeraseL-dopachrome tautomerase (EC:5.3.3.12) Phenylpyruvate tautomerase

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

PMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DNA Ligase III (LIG3) (NM_013975) Human Over-expression Lysate
LS003980 100 µg

DNA Ligase III (LIG3) (NM_013975) Human Over-expression Lysate

Sign In for Pricing
View Details
SBNO1 (NM_018183) Human Tagged ORF Clone
RC221880 10 µg

SBNO1 (NM_018183) Human Tagged ORF Clone

Sign In for Pricing
View Details
SIGLEC1 Recombinant Protein
OPCD06972-50UG 50 µg

SIGLEC1 Recombinant Protein

Sign In for Pricing
View Details
C1orf229 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K0219207 1.0 µg DNA

C1orf229 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Lentiviral human ABCB9 shRNA (UAS) - Lentiviral human ABCB9 shRNA (UAS, GFP) plasmid
GTR15351025 1 Vial

Lentiviral human ABCB9 shRNA (UAS) - Lentiviral human ABCB9 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Recombinant Human BBSome-interacting protein 1 (BBIP1)
MBS1177737-01 0.02 mg (E-Coli)

Recombinant Human BBSome-interacting protein 1 (BBIP1)

Sign In for Pricing
View Details