Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Heat shock protein 75 kDa, mitochondrial (TRAP1), partial

Recombinant Human Heat shock protein 75 kDa, mitochondrial (TRAP1), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: TRAP1. Target Synonyms: TNFR-associated protein 1Tumor necrosis factor type 1 receptor-associated protein; TRAP-1. Accession Number: Q12931. Expression Region: 60~308aa. Tag Info: N-Terminal Gst-Tagged. Theoretical MW: 54.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Heat shock protein 75 kDa, mitochondrial (TRAP1), partial is a purified Recombinant Protein.

Accession Number

Q12931

Expression Region

60~308aa

Host

E. coli

Target

TRAP1

Conjugation

Unconjugated

Tag

N-Terminal Gst-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

54.5kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

TNFR-associated protein 1Tumor necrosis factor type 1 receptor-associated protein; TRAP-1

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

STQTAEDKEEPLHSIISSTESVQGSTSKHEFQAETKKLLDIVARSLYSEKEVFIRELISNASDALEKLRHKLVSDGQALPEMEIHLQTNAEKGTITIQDTGIGMTQEELVSNLGTIARSGSKAFLDALQNQAEASSKIIGQFGVGFYSAFMVADRVEVYSRSAAPGSLGYQWLSDGSGVFEIAEASGVRTGTKIIIHLKSDCKEFSSEARVRDVVTKYSNFVSFPLYLNGRRMNTLQAIWMMDPKDVRE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRIM29 (TRIM29/1041), CF568 conjugate, 0.1mg/mL
BNC681041-500 1x 500 µL

TRIM29 (TRIM29/1041), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Guanosine 3’,5’-Cyclic Monophosphate Sodium Salt
TRC-G837960-10MG 10 mg

Guanosine 3’,5’-Cyclic Monophosphate Sodium Salt

Sign In for Pricing
View Details
CNTROB (NM_053051) Human Over-expression Lysate
LY403286 100 µg

CNTROB (NM_053051) Human Over-expression Lysate

Sign In for Pricing
View Details
CD54 (W-CAM-1; same as Wehi-CAM-1 or 1H4), CF647 conjugate, 0.1mg/mL
BNC470988-100 1x 100 µL

CD54 (W-CAM-1; same as Wehi-CAM-1 or 1H4), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Calnexin (Endoplasmic Reticulum Marker) (CANX/1541), Biotin conjugate, 0.1mg/mL
BNCB1541-100 1x 100 µL

Calnexin (Endoplasmic Reticulum Marker) (CANX/1541), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Blocks, Prostate
CB529911 1 Block

Frozen Tissue Blocks, Prostate

Sign In for Pricing
View Details