Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Heat shock protein 75 kDa, mitochondrial (TRAP1), partial

Recombinant Human Heat shock protein 75 kDa, mitochondrial (TRAP1), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: TRAP1. Target Synonyms: TNFR-associated protein 1Tumor necrosis factor type 1 receptor-associated protein; TRAP-1. Accession Number: Q12931. Expression Region: 60~308aa. Tag Info: N-Terminal Gst-Tagged. Theoretical MW: 54.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Heat shock protein 75 kDa, mitochondrial (TRAP1), partial is a purified Recombinant Protein.

Accession Number

Q12931

Expression Region

60~308aa

Host

E. coli

Target

TRAP1

Conjugation

Unconjugated

Tag

N-Terminal Gst-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

54.5kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

TNFR-associated protein 1Tumor necrosis factor type 1 receptor-associated protein; TRAP-1

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

STQTAEDKEEPLHSIISSTESVQGSTSKHEFQAETKKLLDIVARSLYSEKEVFIRELISNASDALEKLRHKLVSDGQALPEMEIHLQTNAEKGTITIQDTGIGMTQEELVSNLGTIARSGSKAFLDALQNQAEASSKIIGQFGVGFYSAFMVADRVEVYSRSAAPGSLGYQWLSDGSGVFEIAEASGVRTGTKIIIHLKSDCKEFSSEARVRDVVTKYSNFVSFPLYLNGRRMNTLQAIWMMDPKDVRE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EAN57 (TEX33) (NM_001163857) Human Over-expression Lysate
LY431239 100 µg

EAN57 (TEX33) (NM_001163857) Human Over-expression Lysate

Sign In for Pricing
View Details
ARF1 (Golgi Apparatus Marker) (ARF1/2117), CF640R conjugate, 0.1mg/mL
BNC402117-100 1x 100 µL

ARF1 (Golgi Apparatus Marker) (ARF1/2117), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human TNFRSF17 Protein (Sumo Tag)
PDEH100545-01 20 µg

Recombinant Human TNFRSF17 Protein (Sumo Tag)

Sign In for Pricing
View Details
Recombinant Human TNFRSF17 Protein (Sumo Tag)
PDEH100545-02 100 µg

Recombinant Human TNFRSF17 Protein (Sumo Tag)

Sign In for Pricing
View Details
Recombinant Human TNFRSF17 Protein (Sumo Tag)
PDEH100545-03 500 µg

Recombinant Human TNFRSF17 Protein (Sumo Tag)

Sign In for Pricing
View Details
Recombinant Human TNFRSF17 Protein (Sumo Tag)
PDEH100545-04 1 mg

Recombinant Human TNFRSF17 Protein (Sumo Tag)

Sign In for Pricing
View Details