Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cystatin-B (CSTB)

Recombinant Human Cystatin-B (CSTB) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: CSTB. Target Synonyms: CPI-BLiver thiol proteinase inhibitorStefin-B. Accession Number: P04080. Expression Region: 1~98aa. Tag Info: N-Terminal Gst-Tagged. Theoretical MW: 38.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Cystatin-B (CSTB) is a purified Recombinant Protein.

Accession Number

P04080

Expression Region

1~98aa

Host

E. coli

Target

CSTB

Conjugation

Unconjugated

Tag

N-Terminal Gst-Tagged

Field of Research

Cell Biology

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

38.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

CPI-BLiver thiol proteinase inhibitorStefin-B

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

MMCGAPSATQPATAETQHIADQVRSQLEEKENKKFPVFKAVSFKSQVVAGTNYFIKVHVGDEDFVHLRVFQSLPHENKPLTLSNYQTNKAKHDELTYF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM129 CRISPR All-in-one AAV vector set (with saCas9)(Human)
46884151 3x 1.0 µg DNA

TMEM129 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
Rsk 2/MAPKAP Kinase 1b Rabbit Monoclonal Antibody
AMRe87186-01 1 Each

Rsk 2/MAPKAP Kinase 1b Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Rsk 2/MAPKAP Kinase 1b Rabbit Monoclonal Antibody
AMRe87186-02 50 µL

Rsk 2/MAPKAP Kinase 1b Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Rsk 2/MAPKAP Kinase 1b Rabbit Monoclonal Antibody
AMRe87186-03 100 µL

Rsk 2/MAPKAP Kinase 1b Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
FH Antibody
orb670417-01 50 µg

FH Antibody

Sign In for Pricing
View Details
FH Antibody
orb670417-02 100 µg

FH Antibody

Sign In for Pricing
View Details