Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Variola virus 14 kDa fusion protein (A27L)

Recombinant Variola virus 14 kDa fusion protein (A27L) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Mammalian Cell. Endotoxin Level: Not Tested. Species: Smallpox virus. Target Name: A27L. Target Synonyms: A27L; A30L14 kDa fusion protein. Accession Number: P33816. Expression Region: 1~110aa. Tag Info: N-Terminal 10Xhis-Tagged. Theoretical MW: 15.0kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Variola virus 14 kDa fusion protein (A27L) is a purified Recombinant Protein.

Accession Number

P33816

Expression Region

1~110aa

Host

Mammalian Cells

Target

A27L

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged

Field of Research

Microbiology

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

15.0kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

A27L; A30L14 kDa fusion protein

Species

Smallpox virus

Protein Name

Recombinant Protein

AA Sequence

MDGTLFPGDDDLAIPATEFFSTKAAKKPEAKREAIVKADGDNNEETLKQRLTNLEKKITNVTTKFEQIEKCCKRNDDVLFRLENHAETLRAAMISLAKKIDVQTGRRPYE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD44 Standard (156-3C11), CF594 conjugate, 0.1mg/mL
BNC940460-100 1x 100 µL

CD44 Standard (156-3C11), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (1.4C3), CF640R conjugate, 0.1mg/mL
BNC400149-500 1x 500 µL

CD106 / VCAM1 (1.4C3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD86 (BU63), CF594 conjugate, 0.1mg/mL
BNC940193-100 1x 100 µL

CD86 (BU63), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD53 (161-2), CF594 conjugate, 0.1mg/mL
BNC940324-500 1x 500 µL

CD53 (161-2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD5 (CD5/54/F6), CF594 conjugate, 0.1mg/mL
BNC940746-500 1x 500 µL

CD5 (CD5/54/F6), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD54 (W-CAM-1; same as Wehi-CAM-1 or 1H4), CF740 conjugate, 0.1mg/mL
BNC740988-500 1x 500 µL

CD54 (W-CAM-1; same as Wehi-CAM-1 or 1H4), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details