Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Monocyte differentiation antigen CD14 (CD14)

Recombinant Human Monocyte differentiation antigen CD14 (CD14) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Mammalian Cell. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: CD14. Target Synonyms: Myeloid cell-specific leucine-rich glycoprotein; CD14. Accession Number: P08571. Expression Region: 20~345aa. Tag Info: N-Terminal 6Xhis-Myc-Tagged. Theoretical MW: 39.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Monocyte differentiation antigen CD14 (CD14) is a purified Recombinant Protein.

Accession Number

P08571

Expression Region

20~345aa

Host

Mammalian Cells

Target

CD14

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Myc-Tagged

Field of Research

Immunology

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

39.2kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Myeloid cell-specific leucine-rich glycoprotein; CD14

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

TTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

BMS1 Protein Vector (Rat) (pPM-C-HA)
PV256400 500 ng

BMS1 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
TNFRSF14 sgRNA CRISPR Lentivector (Human) (Target 3)
K2416404 1.0 µg DNA

TNFRSF14 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Mouse Adenosine A2b Receptor (ADORA2b) ELISA Kit
DLR-ADORA2b-Mu-48T 48 Tests

Mouse Adenosine A2b Receptor (ADORA2b) ELISA Kit

Sign In for Pricing
View Details
Recombinant Rhizobium sp. Uncharacterized protein y4xN (NGR_a00750), partial
MBS1044500 Inquire

Recombinant Rhizobium sp. Uncharacterized protein y4xN (NGR_a00750), partial

Sign In for Pricing
View Details
Rabbit membrane attack complex (MAC) ELISA Kit
EIA06002Rb 1 Kit

Rabbit membrane attack complex (MAC) ELISA Kit

Sign In for Pricing
View Details
TEKT2 Mouse Monoclonal Antibody [Clone:1E6]
E45M19334 100 µg

TEKT2 Mouse Monoclonal Antibody [Clone:1E6]

Sign In for Pricing
View Details