Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Complement C1q tumor necrosis factor-related protein 3 (C1QTNF3)

Recombinant Human Complement C1q tumor necrosis factor-related protein 3 (C1QTNF3) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: C1QTNF3. Target Synonyms: Collagenous repeat-containing sequence 26 kDa protein; CORS26Secretory protein CORS26. Accession Number: Q9BXJ4. Expression Region: 23~246aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 28.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Complement C1q tumor necrosis factor-related protein 3 (C1QTNF3) is a purified Recombinant Protein.

Accession Number

Q9BXJ4

Expression Region

23~246aa

Host

E. coli

Target

C1QTNF3

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Field of Research

Metabolism

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

28.2kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Collagenous repeat-containing sequence 26 kDa protein; CORS26Secretory protein CORS26

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

QDEYMESPQTGGLPPDCSKCCHGDYSFRGYQGPPGPPGPPGIPGNHGNNGNNGATGHEGAKGEKGDKGDLGPRGERGQHGPKGEKGYPGIPPELQIAFMASLATHFSNQNSGIIFSSVETNIGNFFDVMTGRFGAPVSGVYFFTFSMMKHEDVEEVYVYLMHNGNTVFSMYSYEMKGKSDTSSNHAVLKLAKGDEVWLRMGNGALHGDHQRFSTFAGFLLFETK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ANKRD6 Rabbit Polyclonal Antibody (Center)
E28PB1118 100 µL

ANKRD6 Rabbit Polyclonal Antibody (Center)

Sign In for Pricing
View Details
Mouse Monoclonal p15INK4b/CDKN2B Antibody (OTI3B6) [FITC]
NBP2-73184F 0.1 mL

Mouse Monoclonal p15INK4b/CDKN2B Antibody (OTI3B6) [FITC]

Sign In for Pricing
View Details
HeLa S3 Luciferase Reporter Cell Line
ABC-RC612H 1 Vial

HeLa S3 Luciferase Reporter Cell Line

Sign In for Pricing
View Details
MSHR Antibody
MBS8515694-01 0.1 mg

MSHR Antibody

Sign In for Pricing
View Details
MSHR Antibody
MBS8515694-02 0.1 mL (AF635)

MSHR Antibody

Sign In for Pricing
View Details
MSHR Antibody
MBS8515694-03 0.1 mL (AF610)

MSHR Antibody

Sign In for Pricing
View Details