Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human SUMO-activating enzyme subunit 1 (SAE1)

Recombinant Human SUMO-activating enzyme subunit 1 (SAE1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: SAE1. Target Synonyms: Ubiquitin-like 1-activating enzyme E1A. Accession Number: Q9UBE0. Expression Region: 1~346aa. Tag Info: N-Terminal Gst-Tagged. Theoretical MW: 65.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human SUMO-activating enzyme subunit 1 (SAE1) is a purified Recombinant Protein.

Accession Number

Q9UBE0

Expression Region

1~346aa

Host

E. coli

Target

SAE1

Conjugation

Unconjugated

Tag

N-Terminal Gst-Tagged

Field of Research

Cell Biology

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

65.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Ubiquitin-like 1-activating enzyme E1A

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

MVEKEEAGGGISEEEAAQYDRQIRLWGLEAQKRLRASRVLLVGLKGLGAEIAKNLILAGVKGLTMLDHEQVTPEDPGAQFLIRTGSVGRNRAEASLERAQNLNPMVDVKVDTEDIEKKPESFFTQFDAVCLTCCSRDVIVKVDQICHKNSIKFFTGDVFGYHGYTFANLGEHEFVEEKTKVAKVSQGVEDGPDTKRAKLDSSETTMVKKKVVFCPVKEALEVDWSSEKAKAALKRTTSDYFLLQVLLKFRTDKGRDPSSDTYEEDSELLLQIRNDVLDSLGISPDLLPEDFVRYCFSEMAPVCAVVGGILAQEIVKALSQRDPPHNNFFFFDGMKGNGIVECLGPK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Heat shock 70kDa protein 13 Human Recombinant
rAP-3405 1 Each

Heat shock 70kDa protein 13 Human Recombinant

Sign In for Pricing
View Details
TIMP-2 Polyclonal Antibody, Cy5 Conjugated
bs-21341R-Cy5 100 µL

TIMP-2 Polyclonal Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
pCMV-SPORT6-Birc5 Plasmid
PVT44727 2 µg

pCMV-SPORT6-Birc5 Plasmid

Sign In for Pricing
View Details
PRLR Protein Vector (Mouse) (pPB-C-His)
PV219498 500 ng

PRLR Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Matrilin 4 (MATN4) Antibody (FITC)
abx317013-01 20 µg

Matrilin 4 (MATN4) Antibody (FITC)

Sign In for Pricing
View Details
Matrilin 4 (MATN4) Antibody (FITC)
abx317013-02 50 µg

Matrilin 4 (MATN4) Antibody (FITC)

Sign In for Pricing
View Details