Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse C-type lectin domain family 4 member A (Clec4a), partial

Recombinant Mouse C-type lectin domain family 4 member A (Clec4a), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Clec4a. Target Synonyms: C-type lectin superfamily member 6Dendritic cell immunoreceptor. Accession Number: Q9QZ15. Expression Region: 70~238aa. Tag Info: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 39.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Mouse C-type lectin domain family 4 member A (Clec4a), partial is a purified Recombinant Protein.

Accession Number

Q9QZ15

Expression Region

70~238aa

Host

E. coli

Target

Clec4a

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged

Field of Research

Immunology

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Extracellular Domain

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

39.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

C-type lectin superfamily member 6Dendritic cell immunoreceptor

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

QKYSQLLEEKKAAKNIMHNELNCTKSVSPMEDKVWSCCPKDWRLFGSHCYLVPTVSSSASWNKSEENCSRMGAHLVVIQSQEEQDFITGILDTHAAYFIGLWDTGHRQWQWVDQTPYEESITFWHNGEPSSGNEKCATIIYRWKTGWGWNDISCSLKQKSVCQMKKINL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C1orf56 Human qPCR Template Standard (NM_017860)
HK201357 1 Kit

C1orf56 Human qPCR Template Standard (NM_017860)

Sign In for Pricing
View Details
ARMC2 ORF Vector (Human) (pORF)
ORF015803 1.0 µg DNA

ARMC2 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Recombinant Chlorobium limicola ATP synthase subunit b (atpF), partial
MBS7053844 Inquire

Recombinant Chlorobium limicola ATP synthase subunit b (atpF), partial

Sign In for Pricing
View Details
PHYH Protein Vector (Mouse) (pPM-C-HA)
PV215876 500 ng

PHYH Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
2-Aminomethylpyrimidine (hydrochloride)
HY-60347A-01 25 g

2-Aminomethylpyrimidine (hydrochloride)

Sign In for Pricing
View Details
2-Aminomethylpyrimidine (hydrochloride)
HY-60347A-02 50 g

2-Aminomethylpyrimidine (hydrochloride)

Sign In for Pricing
View Details