Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cricetulus griseus Peroxiredoxin-1 (PRDX1)

Recombinant Cricetulus griseus Peroxiredoxin-1 (PRDX1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus) . Target Name: PRDX1. Target Synonyms: Thioredoxin peroxidase 2TPX-2. Accession Number: Q9JKY1. Expression Region: 2~199aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 26.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Cricetulus griseus Peroxiredoxin-1 (PRDX1) is a purified Recombinant Protein.

Accession Number

Q9JKY1

Expression Region

2~199aa

Host

E. coli

Target

PRDX1

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Field of Research

Cell Biology

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

26.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Thioredoxin peroxidase 2TPX-2

Species

Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus)

Protein Name

Recombinant Protein

AA Sequence

SSGNAKIGYPAPNFKATAVMPDGQFRDICLSEYRGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWINTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITINDLPVGRSVDEILRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFSKQK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

T4 RNA ligase
MBS5821583 Inquire

T4 RNA ligase

Sign In for Pricing
View Details
Rabbit Polyclonal GPIHBP1 Antibody [Janelia Fluor 646]
NB110-55293JF646 0.1 mL

Rabbit Polyclonal GPIHBP1 Antibody [Janelia Fluor 646]

Sign In for Pricing
View Details
Mouse Kinesin-like protein KIF20A, KIF20A ELISA Kit
MBS9336716-01 48 Well

Mouse Kinesin-like protein KIF20A, KIF20A ELISA Kit

Sign In for Pricing
View Details
Mouse Kinesin-like protein KIF20A, KIF20A ELISA Kit
MBS9336716-02 96 Well

Mouse Kinesin-like protein KIF20A, KIF20A ELISA Kit

Sign In for Pricing
View Details
Mouse Kinesin-like protein KIF20A, KIF20A ELISA Kit
MBS9336716-03 5x 96 Well

Mouse Kinesin-like protein KIF20A, KIF20A ELISA Kit

Sign In for Pricing
View Details
Mouse Kinesin-like protein KIF20A, KIF20A ELISA Kit
MBS9336716-04 10x 96 Well

Mouse Kinesin-like protein KIF20A, KIF20A ELISA Kit

Sign In for Pricing
View Details