Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Eukaryotic translation initiation factor 3 subunit K (EIF3K)

Recombinant Human Eukaryotic translation initiation factor 3 subunit K (EIF3K) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: EIF3K. Target Synonyms: Eukaryotic translation initiation factor 3 subunit 12Muscle-specific gene M9 proteinPLAC-24eIF-3 p25eIF-3 p28EIF3S12. Accession Number: Q9UBQ5. Expression Region: 2~218aa. Tag Info: N-Terminal Gst-Tagged. Theoretical MW: 51.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Eukaryotic translation initiation factor 3 subunit K (EIF3K) is a purified Recombinant Protein.

Accession Number

Q9UBQ5

Expression Region

2~218aa

Host

E. coli

Target

EIF3K

Conjugation

Unconjugated

Tag

N-Terminal Gst-Tagged

Field of Research

Epigenetics, Nuclear Signaling

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

51.9kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Eukaryotic translation initiation factor 3 subunit 12Muscle-specific gene M9 proteinPLAC-24eIF-3 p25eIF-3 p28EIF3S12

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

AMFEQMRANVGKLLKGIDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNPAFFQTTVTAQILLKALTNLPHTDFTLCKCMIDQAHQEERPIRQILYLGDLLETCHFQAFWQALDENMDLLEGITGFEDSVRKFICHVVGITYQHIDRWLLAEMLGDLSDSQLKVWMSKYGWSADESGQIFICSQEESIKPKNIVEKIDFDSVSSIMASSQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-CD16/FCGR3 Antibody (1R747)
TMAY-03867-01 20 µL

Anti-CD16/FCGR3 Antibody (1R747)

Sign In for Pricing
View Details
Anti-CD16/FCGR3 Antibody (1R747)
TMAY-03867-02 100 µL

Anti-CD16/FCGR3 Antibody (1R747)

Sign In for Pricing
View Details
NOLC1, NT (NOLC1, KIAA0035, NS5ATP13, Nucleolar and coiled-body phosphoprotein 1, 140kD nucleolar phosphoprotein, Hepatitis C virus NS5A-transactivated protein 13, Nucleolar 130kD protein, Nucleolar phosphoprotein p130) (MaxLight 750)
MBS6325981-01 0.1 mL

NOLC1, NT (NOLC1, KIAA0035, NS5ATP13, Nucleolar and coiled-body phosphoprotein 1, 140kD nucleolar phosphoprotein, Hepatitis C virus NS5A-transactivated protein 13, Nucleolar 130kD protein, Nucleolar phosphoprotein p130) (MaxLight 750)

Sign In for Pricing
View Details
NOLC1, NT (NOLC1, KIAA0035, NS5ATP13, Nucleolar and coiled-body phosphoprotein 1, 140kD nucleolar phosphoprotein, Hepatitis C virus NS5A-transactivated protein 13, Nucleolar 130kD protein, Nucleolar phosphoprotein p130) (MaxLight 750)
MBS6325981-02 5x 0.1 mL

NOLC1, NT (NOLC1, KIAA0035, NS5ATP13, Nucleolar and coiled-body phosphoprotein 1, 140kD nucleolar phosphoprotein, Hepatitis C virus NS5A-transactivated protein 13, Nucleolar 130kD protein, Nucleolar phosphoprotein p130) (MaxLight 750)

Sign In for Pricing
View Details
RNF113A Rabbit pAb
MBS9145630-01 0.02 mL

RNF113A Rabbit pAb

Sign In for Pricing
View Details
RNF113A Rabbit pAb
MBS9145630-02 0.1 mL

RNF113A Rabbit pAb

Sign In for Pricing
View Details