Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus halodurans Putative adenine deaminase BH0637 (BH0637), partial

Recombinant Bacillus halodurans Putative adenine deaminase BH0637 (BH0637), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) . Target Name: BH0637. Target Synonyms: BH0637; Putative adenine deaminase BH0637; Adenase; Adenine aminase; EC 3.5.4.2. Accession Number: Q9KF49. Expression Region: 1~328aa. Tag Info: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 57.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Bacillus halodurans Putative adenine deaminase BH0637 (BH0637), partial is a purified Recombinant Protein.

Accession Number

Q9KF49

Expression Region

1~328aa

Host

E. coli

Target

BH0637

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

57.7kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

BH0637; Putative adenine deaminase BH0637; Adenase; Adenine aminase; EC 3.5.4.2

Species

Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)

Protein Name

Recombinant Protein

AA Sequence

MCEQKYRWTKKQIRQQLAVVRGEMAPTLVLKNATYLNSVRGKWLDANIWIYQDRIVYVGQDMPAKLDDETEVVDCGQQVIVPGYIEHHAHPFQLYNPHSFANYAAAMGTTTLINDNLMFFLALEKKKALSMIESLDELPSSMYWWCRYDPQTEMNDEEGHFLNSKIKEWLEHPLVVQGGELTSWPKVITGDDGILHWMQETRRLRKPIEGHFPGASEKTLTQMSLLGVTSDHEAMTGEEVIRRLDLGYMTSLRHSSIRSDLAKILREMKELGIDDFSRCMLTTDGSPPSFYEQGIMDRLIKIALDEGIPPKDAYGMATYYVARYYGLD

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARS2 (SRRT) (NM_015908) Human Tagged ORF Clone
RG214814 10 µg

ARS2 (SRRT) (NM_015908) Human Tagged ORF Clone

Sign In for Pricing
View Details
Anti-Aquaporin 3 Rabbit pAb
GB11533 100 μL

Anti-Aquaporin 3 Rabbit pAb

Sign In for Pricing
View Details
USP8, NT (Ubiquitin Carboxyl-terminal Hydrolase 8, Ubiquitin Thiolesterase 8, Ubiquitin-specific processing Protease 8, Deubiquitinating Enzyme 8, Ubiquitin Isopeptidase Y, hUBPy, KIAA0055, UBPY) (MaxLight 750)
MBS6505088-01 0.1 mL

USP8, NT (Ubiquitin Carboxyl-terminal Hydrolase 8, Ubiquitin Thiolesterase 8, Ubiquitin-specific processing Protease 8, Deubiquitinating Enzyme 8, Ubiquitin Isopeptidase Y, hUBPy, KIAA0055, UBPY) (MaxLight 750)

Sign In for Pricing
View Details
USP8, NT (Ubiquitin Carboxyl-terminal Hydrolase 8, Ubiquitin Thiolesterase 8, Ubiquitin-specific processing Protease 8, Deubiquitinating Enzyme 8, Ubiquitin Isopeptidase Y, hUBPy, KIAA0055, UBPY) (MaxLight 750)
MBS6505088-02 5x 0.1 mL

USP8, NT (Ubiquitin Carboxyl-terminal Hydrolase 8, Ubiquitin Thiolesterase 8, Ubiquitin-specific processing Protease 8, Deubiquitinating Enzyme 8, Ubiquitin Isopeptidase Y, hUBPy, KIAA0055, UBPY) (MaxLight 750)

Sign In for Pricing
View Details
CD160, Recombinant, Human, aa27-159, His-Tag (CD160 Antigen, BY55, NK1, NK28)
377727 20 µg

CD160, Recombinant, Human, aa27-159, His-Tag (CD160 Antigen, BY55, NK1, NK28)

Sign In for Pricing
View Details
Mouse CAR/CXADR HEK293 Overexpression Lysate
MBS8116296-01 0.3 mg

Mouse CAR/CXADR HEK293 Overexpression Lysate

Sign In for Pricing
View Details