Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Uroplakin-3a (Upk3a), partial

Recombinant Mouse Uroplakin-3a (Upk3a), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Upk3a. Target Synonyms: Uroplakin IIIUPIIIUpk3. Accession Number: Q9JKX8. Expression Region: 19~207aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 25.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Mouse Uroplakin-3a (Upk3a), partial is a purified Recombinant Protein.

Accession Number

Q9JKX8

Expression Region

19~207aa

Host

E. coli

Target

Upk3a

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Field of Research

Tags & Cell Markers

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

25.5kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Uroplakin IIIUPIIIUpk3

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

VNLQPQLASVTFATNNPTLTTVALEKPLCMFDSSEPLSGSYEVYLYAMVDSAMSRNVSVQDSAGVPLSTTFRQTQGGRSGPYKAAAFDLTPCGDLPSLDAVGDVTQASEILNAYLVRVGNNGTCFWDPNFQGLCNPPLTAATEYRFKYVLVNMSTGLVQDQTLWSDPIWTNRPIPYSAIDTWPGRRSGG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glutathione S Transferase theta 2 (GSTT2) Mouse Monoclonal Antibody [Clone ID: OTI6C4]
TA501883S 30 µL

Glutathione S Transferase theta 2 (GSTT2) Mouse Monoclonal Antibody [Clone ID: OTI6C4]

Sign In for Pricing
View Details
Eef1b2 sgRNA CRISPR Lentivector set (Rat)
K6406801 3x 1.0 µg

Eef1b2 sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
Olfactory receptor 5B12 Antibody
E18-9145-2 100 µg -100 µL

Olfactory receptor 5B12 Antibody

Sign In for Pricing
View Details
Phospho-GRK2 (Ser685) Cell-Based ELISA Kit
CBP1803 1 Kit

Phospho-GRK2 (Ser685) Cell-Based ELISA Kit

Sign In for Pricing
View Details
Olfr1196 Protein Vector (Mouse) (pPM-C-HA)
PV208492 500 ng

Olfr1196 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Human Neuroblastoma breakpoint family member 10, NBPF10 ELISA Kit
MBS9325457-01 48 Well

Human Neuroblastoma breakpoint family member 10, NBPF10 ELISA Kit

Sign In for Pricing
View Details