Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Collectrin (Cltrn), partial

Recombinant Mouse Collectrin (Cltrn), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Cltrn. Target Synonyms: Transmembrane protein 27. Accession Number: Q9ESG4. Expression Region: 15~141aa. Tag Info: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 34.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Mouse Collectrin (Cltrn), partial is a purified Recombinant Protein.

Accession Number

Q9ESG4

Expression Region

15~141aa

Host

E. coli

Target

Cltrn

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged

Field of Research

Signal Transduction

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Extracellular Domain

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

34.5kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Transmembrane protein 27

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

ELCHPDAENAFKVRLSIRAALGDKAYVWDTDQEYLFRAMVAFSMRKVPNREATEISHVLLCNITQRVSFWFVVTDPSNNYTLPAAEVQSAIRKNRNRINSAFFLDDHTLEFLKIPSTLAPPMEPSVP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

LTB4-R2 Polyclonal Antibody, PerCP-Cy5.5 Conjugated
bs-2655R-PerCP-Cy5.5 100 µL

LTB4-R2 Polyclonal Antibody, PerCP-Cy5.5 Conjugated

Sign In for Pricing
View Details
ATAD3A Rabbit Polyclonal Antibody (Biotin)
orb445755 100 µL

ATAD3A Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
MUC1 Recombinant Rabbit mAb, PerCP-Cy7 conjugated
orb3125174 100 µL

MUC1 Recombinant Rabbit mAb, PerCP-Cy7 conjugated

Sign In for Pricing
View Details
E/E068/NT/ALU-PHOLUMC-200X200-1 Marine & IMO Signs (No Adhesive)
310907 1 Pack (1 Panel (s) x 1 Pack)

E/E068/NT/ALU-PHOLUMC-200X200-1 Marine & IMO Signs (No Adhesive)

Sign In for Pricing
View Details
RPS3AP32 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV782097 1.0 µg DNA

RPS3AP32 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
LARP2 Double Nickase Plasmid (h)
sc-412454-NIC 20 µg

LARP2 Double Nickase Plasmid (h)

Sign In for Pricing
View Details