Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Collectrin (Cltrn), partial

Recombinant Mouse Collectrin (Cltrn), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Cltrn. Target Synonyms: Transmembrane protein 27. Accession Number: Q9ESG4. Expression Region: 15~141aa. Tag Info: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 34.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Mouse Collectrin (Cltrn), partial is a purified Recombinant Protein.

Accession Number

Q9ESG4

Expression Region

15~141aa

Host

E. coli

Target

Cltrn

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged

Field of Research

Signal Transduction

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Extracellular Domain

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

34.5kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Transmembrane protein 27

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

ELCHPDAENAFKVRLSIRAALGDKAYVWDTDQEYLFRAMVAFSMRKVPNREATEISHVLLCNITQRVSFWFVVTDPSNNYTLPAAEVQSAIRKNRNRINSAFFLDDHTLEFLKIPSTLAPPMEPSVP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCT5 Antibody
A16430-100UL 100 µL

CCT5 Antibody

Sign In for Pricing
View Details
FAM67B 3'UTR GFP Stable Cell Line
TU057367 1.0 mL

FAM67B 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Arfrp1 (NM_001165991) Mouse Tagged ORF Clone Lentiviral Particle
MR221621L4V 200 µL

Arfrp1 (NM_001165991) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Recombinant Human Neutrophil elastase (ELANE), Biotinylated
CSB-EP007587HU-B-01 10 µg

Recombinant Human Neutrophil elastase (ELANE), Biotinylated

Sign In for Pricing
View Details
Recombinant Human Neutrophil elastase (ELANE), Biotinylated
CSB-EP007587HU-B-02 50 µg

Recombinant Human Neutrophil elastase (ELANE), Biotinylated

Sign In for Pricing
View Details
Recombinant Human Neutrophil elastase (ELANE), Biotinylated
CSB-EP007587HU-B-03 200 µg

Recombinant Human Neutrophil elastase (ELANE), Biotinylated

Sign In for Pricing
View Details