Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Staphopain B (sspB)

Recombinant Staphylococcus aureus Staphopain B (sspB) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Staphylococcus aureus (strain Mu50 / ATCC 700699) . Target Name: sspB. Target Synonyms: Staphylococcal cysteine proteinase BStaphylopain B. Accession Number: Q99V46. Expression Region: 220~393aa. Tag Info: N-Terminal Gst-Tagged. Theoretical MW: 46.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Staphylococcus aureus Staphopain B (sspB) is a purified Recombinant Protein.

Accession Number

Q99V46

Expression Region

220~393aa

Host

E. coli

Target

SspB

Conjugation

Unconjugated

Tag

N-Terminal Gst-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

46.9kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Staphylococcal cysteine proteinase BStaphylopain B

Species

Staphylococcus aureus (strain Mu50 / ATCC 700699)

Protein Name

Recombinant Protein

AA Sequence

DQVQYENTLKNFKIREQQFDNSWCAGFSMAALLNATKNTDTYNAHDIMRTLYPEVSEQDLPNCSTFPNQMIEYGKSQGRDIHYQEGVPSYEQVDQLTKDNVGIMILAQSVSQNPNDPHLGHALAVVGNAKINDQEKLIYWNPWDTELSIQDADSSLLHLSFNRDYNWYGSMIGY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Orc6 Mouse Gene Knockout Kit (CRISPR)
KN512629 1 Kit

Orc6 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Olfr596 Lentiviral Activation Particles (m)
sc-437212-LAC 200 µL

Olfr596 Lentiviral Activation Particles (m)

Sign In for Pricing
View Details
C10orf67 Polyclonal Antibody
MBS9433377-01 0.05 mL

C10orf67 Polyclonal Antibody

Sign In for Pricing
View Details
C10orf67 Polyclonal Antibody
MBS9433377-02 0.1 mL

C10orf67 Polyclonal Antibody

Sign In for Pricing
View Details
C10orf67 Polyclonal Antibody
MBS9433377-03 5x 0.1 mL

C10orf67 Polyclonal Antibody

Sign In for Pricing
View Details
C5 Rabbit Polyclonal Antibody (Carrier-free)
orb3119798 100 µg

C5 Rabbit Polyclonal Antibody (Carrier-free)

Sign In for Pricing
View Details