Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Staphopain B (sspB)

Recombinant Staphylococcus aureus Staphopain B (sspB) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Staphylococcus aureus (strain Mu50 / ATCC 700699) . Target Name: sspB. Target Synonyms: Staphylococcal cysteine proteinase BStaphylopain B. Accession Number: Q99V46. Expression Region: 220~393aa. Tag Info: N-Terminal Gst-Tagged. Theoretical MW: 46.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Staphylococcus aureus Staphopain B (sspB) is a purified Recombinant Protein.

Accession Number

Q99V46

Expression Region

220~393aa

Host

E. coli

Target

SspB

Conjugation

Unconjugated

Tag

N-Terminal Gst-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

46.9kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Staphylococcal cysteine proteinase BStaphylopain B

Species

Staphylococcus aureus (strain Mu50 / ATCC 700699)

Protein Name

Recombinant Protein

AA Sequence

DQVQYENTLKNFKIREQQFDNSWCAGFSMAALLNATKNTDTYNAHDIMRTLYPEVSEQDLPNCSTFPNQMIEYGKSQGRDIHYQEGVPSYEQVDQLTKDNVGIMILAQSVSQNPNDPHLGHALAVVGNAKINDQEKLIYWNPWDTELSIQDADSSLLHLSFNRDYNWYGSMIGY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Abcb8 sgRNA CRISPR Lentivector set (Mouse)
K4691201 3x 1.0 µg

Abcb8 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
CYYR1 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
17559156 3x 1.0 µg DNA

CYYR1 CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
Alpha 1 microglobulin Rabbit Polyclonal Antibody (BF555)
orb2400205 100 µL

Alpha 1 microglobulin Rabbit Polyclonal Antibody (BF555)

Sign In for Pricing
View Details
LOC685269 3'UTR Luciferase Stable Cell Line
TU211213 1.0 mL

LOC685269 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Cdc26 (NM_001267055) Rat Tagged ORF Clone
RR215764 10 µg

Cdc26 (NM_001267055) Rat Tagged ORF Clone

Sign In for Pricing
View Details
Human TGFB1 Pre-designed siRNA Set A
SI016552A 1 Each

Human TGFB1 Pre-designed siRNA Set A

Sign In for Pricing
View Details