Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Mitochondrial import inner membrane translocase subunit TIM14 (DNAJC19)

Recombinant Human Mitochondrial import inner membrane translocase subunit TIM14 (DNAJC19) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: DNAJC19. Target Synonyms: DnaJ homolog subfamily C member 19. Accession Number: Q96DA6. Expression Region: 1~116aa. Tag Info: N-Terminal Gst-Tagged. Theoretical MW: 39.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Mitochondrial import inner membrane translocase subunit TIM14 (DNAJC19) is a purified Recombinant Protein.

Accession Number

Q96DA6

Expression Region

1~116aa

Host

E. coli

Target

DNAJC19

Conjugation

Unconjugated

Tag

N-Terminal Gst-Tagged

Field of Research

Signal Transduction

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

39.5kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

DnaJ homolog subfamily C member 19

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

MASTVVAVGLTIAAAGFAGRYVLQAMKHMEPQVKQVFQSLPKSAFSGGYYRGGFEPKMTKREAALILGVSPTANKGKIRDAHRRIMLLNHPDKGGSPYIAAKINEAKDLLEGQAKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Stk32c Mouse qPCR Primer Pair (NM_021302)
MP215273 200 Reactions

Stk32c Mouse qPCR Primer Pair (NM_021302)

Sign In for Pricing
View Details
Phyhipl (NM_178621) Mouse Tagged Lenti ORF Clone
MR217051L4 10 µg

Phyhipl (NM_178621) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
FGG-set siRNA/shRNA/RNAi Lentivector (Human)
20531091 4x 500 ng

FGG-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
Olfr749 (NM_020288) Mouse Tagged ORF Clone Lentiviral Particle
MR220792L3V 200 µL

Olfr749 (NM_020288) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
NOXA1 shRNA Plasmid (h)
sc-92533-SH 20 µg

NOXA1 shRNA Plasmid (h)

Sign In for Pricing
View Details
RGD1308874 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K7359607 1.0 µg DNA

RGD1308874 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details