Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Endothelial cell-selective adhesion molecule (ESAM), partial

Recombinant Human Endothelial cell-selective adhesion molecule (ESAM), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: ESAM. Target Synonyms: 2310008D05Rik; Endothelial cell adhesion molecule; Endothelial cell selective adhesion molecule; Endothelial cell-selective adhesion molecule; Esam; ESAM_HUMAN; HUEL (C4orf1) interacting protein; LP4791 protein; W117m. Accession Number: Q96AP7. Expression Region: 30~248aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 39.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Endothelial cell-selective adhesion molecule (ESAM), partial is a purified Recombinant Protein.

Accession Number

Q96AP7

Expression Region

30~248aa

Host

E. coli

Target

ESAM

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Sumo-Tagged

Field of Research

Cell Adhesion

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Extracellular Domain

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

39.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

2310008D05Rik; Endothelial cell adhesion molecule; Endothelial cell selective adhesion molecule; Endothelial cell-selective adhesion molecule; Esam; ESAM_HUMAN; HUEL (C4orf1) interacting protein; LP4791 protein; W117m

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

QLQLHLPANRLQAVEGGEVVLPAWYTLHGEVSSSQPWEVPFVMWFFKQKEKEDQVLSYINGVTTSKPGVSLVYSMPSRNLSLRLEGLQEKDSGPYSCSVNVQDKQGKSRGHSIKTLELNVLVPPAPPSCRLQGVPHVGANVTLSCQSPRSKPAVQYQWDRQLPSFQTFFAPALDVIRGSLSLTNLSSSMAGVYVCKAHNEVGTAQCNVTLEVSTGPGAA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Campylobacter Curvus ndk Protein (aa 1-137)
VAng-Lsx5980-50gEcoli 50 µg (E. coli)

Recombinant Campylobacter Curvus ndk Protein (aa 1-137)

Sign In for Pricing
View Details
SCRG1 siRNA (Human)
CRH7768-01 15 nmol

SCRG1 siRNA (Human)

Sign In for Pricing
View Details
SCRG1 siRNA (Human)
CRH7768-02 30 nmol

SCRG1 siRNA (Human)

Sign In for Pricing
View Details
Human PLXNC1 Protein Lysate
MBS8417423-01 0.02 mg

Human PLXNC1 Protein Lysate

Sign In for Pricing
View Details
Human PLXNC1 Protein Lysate
MBS8417423-02 5x 0.02 mg

Human PLXNC1 Protein Lysate

Sign In for Pricing
View Details
DACH1 Antibody, FITC conjugated
CSB-PA006482LC01HU-01 50 µg

DACH1 Antibody, FITC conjugated

Sign In for Pricing
View Details