Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ubiquitin carboxyl-terminal hydrolase 7 (USP7), partial

Recombinant Human Ubiquitin carboxyl-terminal hydrolase 7 (USP7), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: USP7. Target Synonyms: Deubiquitinating enzyme 7Herpesvirus-associated ubiquitin-specific proteaseUbiquitin thioesterase 7Ubiquitin-specific-processing protease 7. Accession Number: Q93009. Expression Region: 214~521aa. Tag Info: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 55.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Ubiquitin carboxyl-terminal hydrolase 7 (USP7), partial is a purified Recombinant Protein.

Accession Number

Q93009

Expression Region

214~521aa

Host

E. coli

Target

USP7

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged

Field of Research

Cell Biology

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

55.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Deubiquitinating enzyme 7Herpesvirus-associated ubiquitin-specific proteaseUbiquitin thioesterase 7Ubiquitin-specific-processing protease 7

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

VGLKNQGATCYMNSLLQTLFFTNQLRKAVYMMPTEGDDSSKSVPLALQRVFYELQHSDKPVGTKKLTKSFGWETLDSFMQHDVQELCRVLLDNVENKMKGTCVEGTIPKLFRGKMVSYIQCKEVDYRSDRREDYYDIQLSIKGKKNIFESFVDYVAVEQLDGDNKYDAGEHGLQEAEKGVKFLTLPPVLHLQLMRFMYDPQTDQNIKINDRFEFPEQLPLDEFLQKTDPKDPANYILHAVLVHSGDNHGGHYVVYLNPKGDGKWCKFDDDVVSRCTKEEAIEHNYGGHDDDLSVRHCTNAYMLVYIRE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45RO (190-2F2.5), CF594 conjugate, 0.1mg/mL
BNC941081-100 1x 100 µL

CD45RO (190-2F2.5), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (58M1), CF740 conjugate, 0.1mg/mL
BNC741003-500 1x 500 µL

Mucin 5AC (MUC5AC) (58M1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Interleukin 10 (IL10) (Immunoregulation Marker) (IL10/2651R), CF488A conjugate, 0.1mg/mL
BNC882651-100 1x 100 µL

Interleukin 10 (IL10) (Immunoregulation Marker) (IL10/2651R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cyclin E (G1/S-Phase Cyclin) (CCNE1/2460), CF740 conjugate, 0.1mg/mL
BNC742460-500 1x 500 µL

Cyclin E (G1/S-Phase Cyclin) (CCNE1/2460), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PLAP (Placental Alkaline Phosphatase) (ALP/870), CF640R conjugate, 0.1mg/mL
BNC400870-500 1x 500 µL

PLAP (Placental Alkaline Phosphatase) (ALP/870), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Beta-2 Microglobulin (B2M) (BBM.1), CF594 conjugate, 0.1mg/mL
BNC940142-500 1x 500 µL

Beta-2 Microglobulin (B2M) (BBM.1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details