Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Secretoglobin family 3A member 2 (Scgb3a2)

Recombinant Mouse Secretoglobin family 3A member 2 (Scgb3a2) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Scgb3a2. Target Synonyms: Pneumo secretory protein 1. Accession Number: Q920H1. Expression Region: 22~139aa. Tag Info: N-Terminal 6Xhis-Gst-Tagged. Theoretical MW: 43.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Mouse Secretoglobin family 3A member 2 (Scgb3a2) is a purified Recombinant Protein.

Accession Number

Q920H1

Expression Region

22~139aa

Host

E. coli

Target

Scgb3a2

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Gst-Tagged

Field of Research

Epigenetics, Nuclear Signaling

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein of Isoform C

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

43.2kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Pneumo secretory protein 1

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

LLINRLPVVDKLPVPLDDIIPSFDPLKMLLKTLGISVEHLVTGLKKCVDELGPEASEAVKKLLVIIICSYFPGRSLCYVNNLPSFVSVLFLPMICAYPRDSKKQTFAFIERVFEQSKL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

C19orf55 siRNA (Human)
CRJ5566-01 15 nmol

C19orf55 siRNA (Human)

Sign In for Pricing
View Details
C19orf55 siRNA (Human)
CRJ5566-02 30 nmol

C19orf55 siRNA (Human)

Sign In for Pricing
View Details
TCF19 sgRNA CRISPR Lentivector (Human) (Target 3)
K2349504 1.0 µg DNA

TCF19 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Porcine Uroplakin 3A ELISA Kit
MBS064078-01 48 Well

Porcine Uroplakin 3A ELISA Kit

Sign In for Pricing
View Details
Porcine Uroplakin 3A ELISA Kit
MBS064078-02 96 Well

Porcine Uroplakin 3A ELISA Kit

Sign In for Pricing
View Details
Porcine Uroplakin 3A ELISA Kit
MBS064078-03 5x 96 Well

Porcine Uroplakin 3A ELISA Kit

Sign In for Pricing
View Details