Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Selenoprotein M (SELENOM)

Recombinant Human Selenoprotein M (SELENOM) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: SELENOM. Target Synonyms: SELENOM; SELM; Selenoprotein M; SelM. Accession Number: Q8WWX9. Expression Region: 24~145aa. Tag Info: Tag-Free. Theoretical MW: 13.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Selenoprotein M (SELENOM) is a purified Recombinant Protein.

Accession Number

Q8WWX9

Expression Region

24~145aa

Host

E. coli

Target

SELENOM

Conjugation

Unconjugated

Tag

Tag-Free

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

13.9kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

SELENOM; SELM; Selenoprotein M; SelM

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

ATAYRPDWNRLSGLTRARVETCGGSQLNRLKEVKAFVTQDIPFYHNLVMKHLPGADPELVLLGRRYEELERIPLSEMTREEINALVQELGFYRKAAPDAQVPPEYVWAPAKPPEETSDHADL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human paraoxonase,PON ELISA Kit
CN-04536H2 48T

Human paraoxonase,PON ELISA Kit

Sign In for Pricing
View Details
F9 ELISA Kit (Mouse) (OKCD02534)
OKCD02534 96 Well

F9 ELISA Kit (Mouse) (OKCD02534)

Sign In for Pricing
View Details
PTP4A3 (Protein Tyrosine Phosphatase Type 4A, Member 3, PRL3, PRL-3, PRL-R) (FITC)
MBS6434133-01 0.1 mL

PTP4A3 (Protein Tyrosine Phosphatase Type 4A, Member 3, PRL3, PRL-3, PRL-R) (FITC)

Sign In for Pricing
View Details
PTP4A3 (Protein Tyrosine Phosphatase Type 4A, Member 3, PRL3, PRL-3, PRL-R) (FITC)
MBS6434133-02 5x 0.1 mL

PTP4A3 (Protein Tyrosine Phosphatase Type 4A, Member 3, PRL3, PRL-3, PRL-R) (FITC)

Sign In for Pricing
View Details
ELISA kit for Rat Transmembrane protease serine 9 (TMPRSS9)
KTE100083-01 48 Tests

ELISA kit for Rat Transmembrane protease serine 9 (TMPRSS9)

Sign In for Pricing
View Details
ELISA kit for Rat Transmembrane protease serine 9 (TMPRSS9)
KTE100083-02 96 Tests

ELISA kit for Rat Transmembrane protease serine 9 (TMPRSS9)

Sign In for Pricing
View Details