Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chikungunya virus Non-structural protein 4 (nsP4), partial

Recombinant Chikungunya virus Non-structural protein 4 (nsP4), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Chikungunya virus (strain S27-African prototype) (CHIKV) . Target Name: nsp4. Target Synonyms: Polyprotein nsP1234. Accession Number: Q8JUX6. Expression Region: 2228~2474aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 31.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Chikungunya virus Non-structural protein 4 (nsP4), partial is a purified Recombinant Protein.

Accession Number

Q8JUX6

Expression Region

2228~2474aa

Host

E. coli

Target

Nsp4

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

31.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Polyprotein nsP1234

Species

Chikungunya virus (strain S27-African prototype) (CHIKV)

Protein Name

Recombinant Protein

AA Sequence

DTVLETDIASFDKSQDDSLALTALMLLEDLGVDHSLLDLIEAAFGEISSCHLPTGTRFKFGAMMKSGMFLTLFVNTLLNITIASRVLEDRLTKSACAAFIGDDNIIHGVVSDELMAARCATWMNMEVKIIDAVVSQKAPYFCGGFILHDIVTGTACRVADPLKRLFKLGKPLAAGDEQDEDRRRALADEVVRWQRTGLIDELEKAVYSRYEVQGISVVVMSMATFASSRSNFEKLRGPVVTLYGGPK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IFT43 activation kit by CRISPRa
GA114366 1 Kit

Human IFT43 activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant Cytochrome P450 2E1 Antibody
RC-16672-01 50 μL

Recombinant Cytochrome P450 2E1 Antibody

Sign In for Pricing
View Details
Recombinant Cytochrome P450 2E1 Antibody
RC-16672-02 100 µL

Recombinant Cytochrome P450 2E1 Antibody

Sign In for Pricing
View Details
Recombinant Cytochrome P450 2E1 Antibody
RC-16672-03 1 mL

Recombinant Cytochrome P450 2E1 Antibody

Sign In for Pricing
View Details
Mouse Fezf2 activation kit by CRISPRa
GA205766 1 Kit

Mouse Fezf2 activation kit by CRISPRa

Sign In for Pricing
View Details
AFViolet 450 Anti-Mouse CD80 Antibody
RD30111F-01 25 µg

AFViolet 450 Anti-Mouse CD80 Antibody

Sign In for Pricing
View Details