Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca fascicularis Frataxin, mitochondrial (FXN)

Recombinant Macaca fascicularis Frataxin, mitochondrial (FXN) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey) . Target Name: FXN. Target Synonyms: FXN; FRDA1; QnpA-13971; Frataxin; mitochondrial; Fxn; EC 1.16.3.1; Cleaved into: Frataxin intermediate form; Frataxin mature form. Accession Number: Q8HXX9. Expression Region: 81~210aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 18.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Macaca fascicularis Frataxin, mitochondrial (FXN) is a purified Recombinant Protein.

Accession Number

Q8HXX9

Expression Region

81~210aa

Host

E. coli

Target

FXN

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

18.2kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

FXN; FRDA1; QnpA-13971; Frataxin; mitochondrial; Fxn; EC 1.16.3.1; Cleaved into: Frataxin intermediate form; Frataxin mature form

Species

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Protein Name

Recombinant Protein

AA Sequence

SGTLGHPGSLDDTTYERLAEETLDSLAEFFEDLADKPYTFEDYDVSFGSGVLTVKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDRTGKNWVYSHDGVSLHELLGAELTKALKTKLDLSSLAYSGKDA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRKCD Recombinant Monoclonal Antibody
RAC08971-01 50 µL

PRKCD Recombinant Monoclonal Antibody

Sign In for Pricing
View Details
PRKCD Recombinant Monoclonal Antibody
RAC08971-02 100 µL

PRKCD Recombinant Monoclonal Antibody

Sign In for Pricing
View Details
Mouse Argininosuccinate Synthetase 1 (ASS1) ELISA Kit
MBS456976-01 48 Tests

Mouse Argininosuccinate Synthetase 1 (ASS1) ELISA Kit

Sign In for Pricing
View Details
Mouse Argininosuccinate Synthetase 1 (ASS1) ELISA Kit
MBS456976-02 96 Tests

Mouse Argininosuccinate Synthetase 1 (ASS1) ELISA Kit

Sign In for Pricing
View Details
Mouse Argininosuccinate Synthetase 1 (ASS1) ELISA Kit
MBS456976-03 5x 96 Tests

Mouse Argininosuccinate Synthetase 1 (ASS1) ELISA Kit

Sign In for Pricing
View Details
Mouse Argininosuccinate Synthetase 1 (ASS1) ELISA Kit
MBS456976-04 10x 96 Tests

Mouse Argininosuccinate Synthetase 1 (ASS1) ELISA Kit

Sign In for Pricing
View Details