Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Vesicular stomatitis Indiana virus RNA-directed RNA polymerase L (L), partial

Recombinant Vesicular stomatitis Indiana virus RNA-directed RNA polymerase L (L), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Vesicular stomatitis Indiana virus (strain 94GUB Central America) (VSIV) . Target Name: L. Target Synonyms: Large structural proteinReplicaseTranscriptase. Accession Number: Q8B0H0. Expression Region: 598~784aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 25.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Vesicular stomatitis Indiana virus RNA-directed RNA polymerase L (L), partial is a purified Recombinant Protein.

Accession Number

Q8B0H0

Expression Region

598~784aa

Host

E. coli

Target

L

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

25.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Large structural proteinReplicaseTranscriptase

Species

Vesicular stomatitis Indiana virus (strain 94GUB Central America) (VSIV)

Protein Name

Recombinant Protein

AA Sequence

ICIANHIDYEKWNNHQRKLSNGPVFRVMGQFLGYPSLIERTHEFFEKSLIYYNGRPDLMRVHNNTLVNSTSQRVCWQGQEGGLEGLRQKGWSILNLLVIQREAKIRNTAVKVLAQGDNQVICTQYKTKKSRNVVELQSALNQMVSNNEKIMTAIKIGTGKLGLLINDDETMQSADYLNYGKIPIFRG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Jak2 shRNA (UAS) - Lentiviral mouse Jak2 shRNA (UAS, GFP) plasmid
GTR15191854 1 Vial

Lentiviral mouse Jak2 shRNA (UAS) - Lentiviral mouse Jak2 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Ube4a-set siRNA/shRNA/RNAi Lentivector (Rat)
49021096 4x 500 ng

Ube4a-set siRNA/shRNA/RNAi Lentivector (Rat)

Sign In for Pricing
View Details
Aminopeptidase N inhibitor 1
HY-138037 1 Each

Aminopeptidase N inhibitor 1

Sign In for Pricing
View Details
Use1 (NM_001145780) Mouse Tagged ORF Clone Lentiviral Particle
MR203593L4V 200 µL

Use1 (NM_001145780) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
OR52E5 Recombinant Protein (Human)
RP080664 100 µg

OR52E5 Recombinant Protein (Human)

Sign In for Pricing
View Details
Rabbit Polyclonal IGF-II Antibody
NBP2-48510 0.1 mL

Rabbit Polyclonal IGF-II Antibody

Sign In for Pricing
View Details