Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sprouty-related, EVH1 domain-containing protein 1 (SPRED1)

Recombinant Human Sprouty-related, EVH1 domain-containing protein 1 (SPRED1) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: SPRED1. Target Synonyms: EVH1 domain-containing protein 1; EVH1/Sprouty domain containing protein; FLJ33903; hSpred 1; hSpred1; NFLS; PPP1R147; protein phosphatase 1 regulatory subunit 147; SPRE1_HUMAN; SPRED 1; Spred-1; spred1. Accession Number: Q7Z699. Expression Region: 2~444aa. Tag Info: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 70.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Sprouty-related, EVH1 domain-containing protein 1 (SPRED1) is a purified Recombinant Protein.

Accession Number

Q7Z699

Expression Region

2~444aa

Host

E. coli

Target

SPRED1

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged

Field of Research

Signal Transduction

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

70.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

EVH1 domain-containing protein 1; EVH1/Sprouty domain containing protein; FLJ33903; hSpred 1; hSpred1; NFLS; PPP1R147; protein phosphatase 1 regulatory subunit 147; SPRE1_HUMAN; SPRED 1; Spred-1; spred1; Sprouty related EVH1 domain containing 1; sprouty related EVH1 domain containing protein 1; Sprouty related protein 1 with EVH 1 domain; Sprouty-related; Suppressor of Ras/MAPK activation

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

SEETATSDNDNSYARVRAVVMTRDDSSGGWLPLGGSGLSSVTVFKVPHQEENGCADFFIRGERLRDKMVVLECMLKKDLIYNKVTPTFHHWKIDDKKFGLTFQSPADARAFDRGIRRAIEDISQGCPESKNEAEGADDLQANEEDSSSSLVKDHLFQQETVVTSEPYRSSNIRPSPFEDLNARRVYMQSQANQITFGQPGLDIQSRSMEYVQRQISKECGSLKSQNRVPLKSIRHVSFQDEDEIVRINPRDILIRRYADYRHPDMWKNDLERDDADSSIQFSKPDSKKSDYLYSCGDETKLSSPKDSVVFKTQPSSLKIKKSKRRKEDGERSRCVYCQERFNHEENVRGKCQDAPDPIKRCIYQVSCMLCAESMLYHCMSDSEGDFSDPCSCDTSDDKFCLRWLALVALSFIVPCMCCYVPLRMCHRCGEACGCCGGKHKAAG

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

CAMK1G, CT (Calcium/Calmodulin-dependent Protein Kinase IG, CaM Kinase I gamma, CaM Kinase IG, CaM-KI gamma, CaMKI gamma, CaMKIG, CaMK-like CREB Kinase III, CLICK III, VWS1) (MaxLight 550) discontinued
C1035-22H-ML550 100 µL

CAMK1G, CT (Calcium/Calmodulin-dependent Protein Kinase IG, CaM Kinase I gamma, CaM Kinase IG, CaM-KI gamma, CaMKI gamma, CaMKIG, CaMK-like CREB Kinase III, CLICK III, VWS1) (MaxLight 550) discontinued

Ask
View Details
EIF1B, CT (EIF1B, Eukaryotic translation initiation factor 1b, Protein translation factor SUI1 homolog GC20) (MaxLight 750)
MBS6294828-01 0.1 mL

EIF1B, CT (EIF1B, Eukaryotic translation initiation factor 1b, Protein translation factor SUI1 homolog GC20) (MaxLight 750)

Ask
View Details
EIF1B, CT (EIF1B, Eukaryotic translation initiation factor 1b, Protein translation factor SUI1 homolog GC20) (MaxLight 750)
MBS6294828-02 5x 0.1 mL

EIF1B, CT (EIF1B, Eukaryotic translation initiation factor 1b, Protein translation factor SUI1 homolog GC20) (MaxLight 750)

Ask
View Details
Tyrosine Hydroxylase (PTR2544) mouse mAb
W0088-01 20 µL

Tyrosine Hydroxylase (PTR2544) mouse mAb

Ask
View Details
Tyrosine Hydroxylase (PTR2544) mouse mAb
W0088-02 100 µL

Tyrosine Hydroxylase (PTR2544) mouse mAb

Ask
View Details
Tyrosine Hydroxylase (PTR2544) mouse mAb
W0088-03 200 µL

Tyrosine Hydroxylase (PTR2544) mouse mAb

Ask
View Details