Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sprouty-related, EVH1 domain-containing protein 1 (SPRED1)

Recombinant Human Sprouty-related, EVH1 domain-containing protein 1 (SPRED1) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: SPRED1. Target Synonyms: EVH1 domain-containing protein 1; EVH1/Sprouty domain containing protein; FLJ33903; hSpred 1; hSpred1; NFLS; PPP1R147; protein phosphatase 1 regulatory subunit 147; SPRE1_HUMAN; SPRED 1; Spred-1; spred1. Accession Number: Q7Z699. Expression Region: 2~444aa. Tag Info: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 70.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Sprouty-related, EVH1 domain-containing protein 1 (SPRED1) is a purified Recombinant Protein.

Accession Number

Q7Z699

Expression Region

2~444aa

Host

E. coli

Target

SPRED1

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged

Field of Research

Signal Transduction

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

70.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

EVH1 domain-containing protein 1; EVH1/Sprouty domain containing protein; FLJ33903; hSpred 1; hSpred1; NFLS; PPP1R147; protein phosphatase 1 regulatory subunit 147; SPRE1_HUMAN; SPRED 1; Spred-1; spred1; Sprouty related EVH1 domain containing 1; sprouty related EVH1 domain containing protein 1; Sprouty related protein 1 with EVH 1 domain; Sprouty-related; Suppressor of Ras/MAPK activation

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

SEETATSDNDNSYARVRAVVMTRDDSSGGWLPLGGSGLSSVTVFKVPHQEENGCADFFIRGERLRDKMVVLECMLKKDLIYNKVTPTFHHWKIDDKKFGLTFQSPADARAFDRGIRRAIEDISQGCPESKNEAEGADDLQANEEDSSSSLVKDHLFQQETVVTSEPYRSSNIRPSPFEDLNARRVYMQSQANQITFGQPGLDIQSRSMEYVQRQISKECGSLKSQNRVPLKSIRHVSFQDEDEIVRINPRDILIRRYADYRHPDMWKNDLERDDADSSIQFSKPDSKKSDYLYSCGDETKLSSPKDSVVFKTQPSSLKIKKSKRRKEDGERSRCVYCQERFNHEENVRGKCQDAPDPIKRCIYQVSCMLCAESMLYHCMSDSEGDFSDPCSCDTSDDKFCLRWLALVALSFIVPCMCCYVPLRMCHRCGEACGCCGGKHKAAG

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

APC-Linked Polyclonal Antibody to Protein Tyrosine Phosphatase Receptor Type N (PTPRN)
MBS2049951-01 0.1 mL

APC-Linked Polyclonal Antibody to Protein Tyrosine Phosphatase Receptor Type N (PTPRN)

Ask
View Details
APC-Linked Polyclonal Antibody to Protein Tyrosine Phosphatase Receptor Type N (PTPRN)
MBS2049951-02 0.2 mL

APC-Linked Polyclonal Antibody to Protein Tyrosine Phosphatase Receptor Type N (PTPRN)

Ask
View Details
APC-Linked Polyclonal Antibody to Protein Tyrosine Phosphatase Receptor Type N (PTPRN)
MBS2049951-03 0.5 mL

APC-Linked Polyclonal Antibody to Protein Tyrosine Phosphatase Receptor Type N (PTPRN)

Ask
View Details
APC-Linked Polyclonal Antibody to Protein Tyrosine Phosphatase Receptor Type N (PTPRN)
MBS2049951-04 1 mL

APC-Linked Polyclonal Antibody to Protein Tyrosine Phosphatase Receptor Type N (PTPRN)

Ask
View Details
APC-Linked Polyclonal Antibody to Protein Tyrosine Phosphatase Receptor Type N (PTPRN)
MBS2049951-05 5 mL

APC-Linked Polyclonal Antibody to Protein Tyrosine Phosphatase Receptor Type N (PTPRN)

Ask
View Details
APC-Linked Polyclonal Antibody to Protein Tyrosine Phosphatase Receptor Type N (PTPRN)
MBS2049951-06 5x 5 mL

APC-Linked Polyclonal Antibody to Protein Tyrosine Phosphatase Receptor Type N (PTPRN)

Ask
View Details