Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pig Interleukin-4 receptor subunit alpha (IL4R), partial

Recombinant Pig Interleukin-4 receptor subunit alpha (IL4R), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Pig (Sus scrofa; Porcine) . Target Name: IL4R. Target Synonyms: CD_antigen: CD124. Accession Number: Q863Z5. Expression Region: 33~240aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 28.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Pig Interleukin-4 receptor subunit alpha (IL4R), partial is a purified Recombinant Protein.

Accession Number

Q863Z5

Expression Region

33~240aa

Host

E. coli

Target

IL4R

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Field of Research

Cancer

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Extracellular Domain

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

28.2kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

CD_antigen: CD124

Species

Pig (Sus scrofa; Porcine)

Protein Name

Recombinant Protein

AA Sequence

VRVLEWPICLSDYVSTSTCEWRMAGPVNCSAEFRLSYQLKFFNTENHTTCVPENRAGSVCVCHMLMESIVIVDTYQLDLWAGEQLLWNSSFKPSQNVKPLAPRNLMVHANISHTWLLTWSNPYPSESYLYSELTYLVNISNENDPTDFRIYNVTYLGPTLRFPANTLKSGAAYSARVKAWAQRYNSTWSEWSPSVKWLNYYEEPLEQR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SEPTIN12 (NM_144605) Human Over-expression Lysate
LC408232 20 µg

SEPTIN12 (NM_144605) Human Over-expression Lysate

Sign In for Pricing
View Details
RALGAPA1 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
38460124 3x 1.0µg DNA

RALGAPA1 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
PPFIA1 (Protein Tyrosine Phosphatase F Interacting Protein 1) [KO Validated]
502729 200 µL

PPFIA1 (Protein Tyrosine Phosphatase F Interacting Protein 1) [KO Validated]

Sign In for Pricing
View Details
ZNF323 Peptide - middle region
MBS3227900-01 0.1 mg

ZNF323 Peptide - middle region

Sign In for Pricing
View Details
ZNF323 Peptide - middle region
MBS3227900-02 5x 0.1 mg

ZNF323 Peptide - middle region

Sign In for Pricing
View Details
LOC100504830 3'UTR Luciferase Stable Cell Line
TU112175 1.0 mL

LOC100504830 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details