Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Iron-regulated surface determinant protein A (isdA)

Recombinant Staphylococcus aureus Iron-regulated surface determinant protein A (isdA) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Staphylococcus aureus (strain MSSA476) . Target Name: isdA. Target Synonyms: Fur-regulated protein AStaphylococcal transferrin-binding protein AfrpA, stbA. Accession Number: Q6GA85. Expression Region: 47~316aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 35.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Staphylococcus aureus Iron-regulated surface determinant protein A (isdA) is a purified Recombinant Protein.

Accession Number

Q6GA85

Expression Region

47~316aa

Host

E. coli

Target

IsdA

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

35.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Fur-regulated protein AStaphylococcal transferrin-binding protein AfrpA, stbA

Species

Staphylococcus aureus (strain MSSA476)

Protein Name

Recombinant Protein

AA Sequence

ATEATNATNNQSTQVSQATSQPINFQVQKDGSSEKSHMDDYMQHPGKVIKQNNKYYFQTVLNNASFWKEYKFYNANNQELATTVVNDNKKADTRTINVAVEPGYKSLTTKVHIVVPQINYNHRYTTHLEFEKAIPTLADAAKPNNVKPVQPKPAQPKTPTEQTKPVQPKVEKVKPTVTTTSKVEDNHSTKVVSTDTTKDQTKTQTAHTVKTAQTAQEQNKVQTPVKDVATAKSESNNQAVSDNKSQQTNKVTKHNETPKQASKAKELPKT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DLX5 (Distal-less Homeobox 5)
245402 100 µg

DLX5 (Distal-less Homeobox 5)

Sign In for Pricing
View Details
Acvr1b (NM_199230) Rat Tagged ORF Clone Lentiviral Particle
RR207332L3V 200 µL

Acvr1b (NM_199230) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Fascin 1 Lentiviral Activation Particles (m2)
sc-420283-LAC-2 200 µL

Fascin 1 Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details
SLC5A11 Antibody
14-829 100 µL

SLC5A11 Antibody

Sign In for Pricing
View Details
Rhodopsin CRISPR/Cas9 KO Plasmid (h)
sc-401026 20 µg

Rhodopsin CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
Human CD200 Receptor 2 (CD200R2) ELISA Kit
MBS2707346-01 24 Strip Well

Human CD200 Receptor 2 (CD200R2) ELISA Kit

Sign In for Pricing
View Details