Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Iron-regulated surface determinant protein A (isdA)

Recombinant Staphylococcus aureus Iron-regulated surface determinant protein A (isdA) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Staphylococcus aureus (strain MSSA476) . Target Name: isdA. Target Synonyms: Fur-regulated protein AStaphylococcal transferrin-binding protein AfrpA, stbA. Accession Number: Q6GA85. Expression Region: 47~316aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 35.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Staphylococcus aureus Iron-regulated surface determinant protein A (isdA) is a purified Recombinant Protein.

Accession Number

Q6GA85

Expression Region

47~316aa

Host

E. coli

Target

IsdA

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

35.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Fur-regulated protein AStaphylococcal transferrin-binding protein AfrpA, stbA

Species

Staphylococcus aureus (strain MSSA476)

Protein Name

Recombinant Protein

AA Sequence

ATEATNATNNQSTQVSQATSQPINFQVQKDGSSEKSHMDDYMQHPGKVIKQNNKYYFQTVLNNASFWKEYKFYNANNQELATTVVNDNKKADTRTINVAVEPGYKSLTTKVHIVVPQINYNHRYTTHLEFEKAIPTLADAAKPNNVKPVQPKPAQPKTPTEQTKPVQPKVEKVKPTVTTTSKVEDNHSTKVVSTDTTKDQTKTQTAHTVKTAQTAQEQNKVQTPVKDVATAKSESNNQAVSDNKSQQTNKVTKHNETPKQASKAKELPKT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TNIK (NM_001161561) Human Tagged Lenti ORF Clone
RC228673L3 10 µg

TNIK (NM_001161561) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
GABRB2 Protein Vector (Human) (pPM-C-HA)
PV052475 500 ng

GABRB2 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
KCTD15 Rabbit pAb
A8256-01 20 µL

KCTD15 Rabbit pAb

Sign In for Pricing
View Details
KCTD15 Rabbit pAb
A8256-02 100 μL

KCTD15 Rabbit pAb

Sign In for Pricing
View Details
KCTD15 Rabbit pAb
A8256-03 500 μL

KCTD15 Rabbit pAb

Sign In for Pricing
View Details
KCTD15 Rabbit pAb
A8256-04 1000 μL

KCTD15 Rabbit pAb

Sign In for Pricing
View Details