Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Zaire ebolavirus Matrix protein VP40 (VP40)

Recombinant Zaire ebolavirus Matrix protein VP40 (VP40) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Zaire ebolavirus (strain Kikwit-95) (ZEBOV) (Zaire Ebola virus) . Target Name: VP40. Target Synonyms: Membrane-associated protein VP40. Accession Number: Q77DJ6. Expression Region: 1~326AA. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 51.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Zaire ebolavirus Matrix protein VP40 (VP40) is a purified Recombinant Protein.

Accession Number

Q77DJ6

Expression Region

1~326AA

Host

E. coli

Target

VP40

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Sumo-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

51.2kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Membrane-associated protein VP40

Species

Zaire ebolavirus (strain Kikwit-95) (ZEBOV)

Protein Name

Recombinant Protein

AA Sequence

MRRVILPTAPPEYMEAIYPVRSNSTIARGGNSNTGFLTPESVNGDTPSNPLRPIADDTIDHASHTPGSVSSAFILEAMVNVISGPKVLMKQIPIWLPLGVADQKTYSFDSTTAAIMLASYTITHFGKATNPLVRVNRLGPGIPDHPLRLLRIGNQAFLQEFVLPPVQLPQYFTFDLTALKLITQPLPAATWTDDTPTGSNGALRPGISFHPKLRPILLPNKSGKKGNSADLTSPEKIQAIMTSLQDFKIVPIDPTKNIMGIEVPETLVHKLTGKKVTSKNGQPIIPVLLPKYIGLDPVAPGDLTMVITQDCDTCHSPASLPAVIEK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-PIGY Antibody
A14537 100 µL

Anti-PIGY Antibody

Sign In for Pricing
View Details
hsa-miR-3155a miRNA Inhibitor
MIH01777 2x 5.0 nmol

hsa-miR-3155a miRNA Inhibitor

Sign In for Pricing
View Details
APC_Cy7 Linked Monoclonal Antibody to Lipopolysaccharide (LPS)
MBS2133250 Inquire

APC_Cy7 Linked Monoclonal Antibody to Lipopolysaccharide (LPS)

Sign In for Pricing
View Details
T150A, ID (TMEM150A, TMEM150, Transmembrane protein 150A, Transmembrane protein 150) (MaxLight 490) discontinued
042551-ML490 100 µL

T150A, ID (TMEM150A, TMEM150, Transmembrane protein 150A, Transmembrane protein 150) (MaxLight 490) discontinued

Sign In for Pricing
View Details
Mouse Ubqln4 Pre-designed siRNA Set A
SI115621A 1 Each

Mouse Ubqln4 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Rabbit Deubiquitinating enzyme ELISA Kit
MBS720404-01 48 Well

Rabbit Deubiquitinating enzyme ELISA Kit

Sign In for Pricing
View Details