Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Zaire ebolavirus Matrix protein VP40 (VP40)

Recombinant Zaire ebolavirus Matrix protein VP40 (VP40) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Zaire ebolavirus (strain Kikwit-95) (ZEBOV) (Zaire Ebola virus) . Target Name: VP40. Target Synonyms: Membrane-associated protein VP40. Accession Number: Q77DJ6. Expression Region: 1~326AA. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 51.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Zaire ebolavirus Matrix protein VP40 (VP40) is a purified Recombinant Protein.

Accession Number

Q77DJ6

Expression Region

1~326AA

Host

E. coli

Target

VP40

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Sumo-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

51.2kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Membrane-associated protein VP40

Species

Zaire ebolavirus (strain Kikwit-95) (ZEBOV)

Protein Name

Recombinant Protein

AA Sequence

MRRVILPTAPPEYMEAIYPVRSNSTIARGGNSNTGFLTPESVNGDTPSNPLRPIADDTIDHASHTPGSVSSAFILEAMVNVISGPKVLMKQIPIWLPLGVADQKTYSFDSTTAAIMLASYTITHFGKATNPLVRVNRLGPGIPDHPLRLLRIGNQAFLQEFVLPPVQLPQYFTFDLTALKLITQPLPAATWTDDTPTGSNGALRPGISFHPKLRPILLPNKSGKKGNSADLTSPEKIQAIMTSLQDFKIVPIDPTKNIMGIEVPETLVHKLTGKKVTSKNGQPIIPVLLPKYIGLDPVAPGDLTMVITQDCDTCHSPASLPAVIEK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olr135 Recombinant Protein (Rat)
RP215894 100 µg

Olr135 Recombinant Protein (Rat)

Sign In for Pricing
View Details
ZNF791 (Zinc Finger Protein 791)
496873 100 µL

ZNF791 (Zinc Finger Protein 791)

Sign In for Pricing
View Details
Histone H4 / HIST1H4A (H4C1) Antibody
abx343413-01 20 µL

Histone H4 / HIST1H4A (H4C1) Antibody

Sign In for Pricing
View Details
Histone H4 / HIST1H4A (H4C1) Antibody
abx343413-02 50 µL

Histone H4 / HIST1H4A (H4C1) Antibody

Sign In for Pricing
View Details
Histone H4 / HIST1H4A (H4C1) Antibody
abx343413-03 100 µL

Histone H4 / HIST1H4A (H4C1) Antibody

Sign In for Pricing
View Details
Histone H4 / HIST1H4A (H4C1) Antibody
abx343413-04 200 µL

Histone H4 / HIST1H4A (H4C1) Antibody

Sign In for Pricing
View Details