Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Arachis hypogaea Conglutin-7

Recombinant Arachis hypogaea Conglutin-7 is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Arachis hypogaea (Peanut) . Target Name: Arachis hypogaea Conglutin-7. Target Synonyms: Conglutin-7; 2S protein 1; Seed storage protein SSP1; Seed storage protein SSP2; allergen Ara h 2. Accession Number: Q6PSU2. Expression Region: 22~172aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 22kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Arachis hypogaea Conglutin-7 is a purified Recombinant Protein.

Accession Number

Q6PSU2

Expression Region

22~172aa

Host

E. coli

Target

Arachis hypogaea Conglutin-7

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

22kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Conglutin-7; 2S protein 1; Seed storage protein SSP1; Seed storage protein SSP2; allergen Ara h 2

Species

Arachis hypogaea (Peanut)

Protein Name

Recombinant Protein

AA Sequence

RQQWELQGDRRCQSQLERANLRPCEQHLMQKIQRDEDSYGRDPYSPSQDPYSPSQDPDRRDPYSPSPYDRRGAGSSQHQERCCNELNEFENNQRCMCEALQQIMENQSDRLQGRQQEQQFKRELRNLPQQCGLRAPQRCDLEVESGGRDRY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal LIMPII/SR-B2 Antibody (017) [DyLight 680]
NBP2-90381FR 0.1 mL

Rabbit Monoclonal LIMPII/SR-B2 Antibody (017) [DyLight 680]

Sign In for Pricing
View Details
Ardisiacrispin A 10mg
A14638-10 10 mg

Ardisiacrispin A 10mg

Sign In for Pricing
View Details
NAA10 (ARD1, N-alpha-acetyltransferase 10, N-terminal Acetyltransferase Complex ARD1 Subunit Homolog A, NatA Catalytic Subunit, ARD1A, TE2, DXS707, MGC71248) (HRP) discontinued
123461-HRP 100 µL

NAA10 (ARD1, N-alpha-acetyltransferase 10, N-terminal Acetyltransferase Complex ARD1 Subunit Homolog A, NatA Catalytic Subunit, ARD1A, TE2, DXS707, MGC71248) (HRP) discontinued

Sign In for Pricing
View Details
NPR1 Biosimilar Antibody
orb3182802-01 100 µg

NPR1 Biosimilar Antibody

Sign In for Pricing
View Details
NPR1 Biosimilar Antibody
orb3182802-02 500 µg

NPR1 Biosimilar Antibody

Sign In for Pricing
View Details
NPR1 Biosimilar Antibody
orb3182802-03 1 mg

NPR1 Biosimilar Antibody

Sign In for Pricing
View Details