Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Arachis hypogaea Conglutin-7

Recombinant Arachis hypogaea Conglutin-7 is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Arachis hypogaea (Peanut) . Target Name: Arachis hypogaea Conglutin-7. Target Synonyms: Conglutin-7; 2S protein 1; Seed storage protein SSP1; Seed storage protein SSP2; allergen Ara h 2. Accession Number: Q6PSU2. Expression Region: 22~172aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 22kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Arachis hypogaea Conglutin-7 is a purified Recombinant Protein.

Accession Number

Q6PSU2

Expression Region

22~172aa

Host

E. coli

Target

Arachis hypogaea Conglutin-7

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

22kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Conglutin-7; 2S protein 1; Seed storage protein SSP1; Seed storage protein SSP2; allergen Ara h 2

Species

Arachis hypogaea (Peanut)

Protein Name

Recombinant Protein

AA Sequence

RQQWELQGDRRCQSQLERANLRPCEQHLMQKIQRDEDSYGRDPYSPSQDPYSPSQDPDRRDPYSPSPYDRRGAGSSQHQERCCNELNEFENNQRCMCEALQQIMENQSDRLQGRQQEQQFKRELRNLPQQCGLRAPQRCDLEVESGGRDRY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse CD40 Ligand/TNFSF5 ELISA Kit
OK-0673 1 Kit

Mouse CD40 Ligand/TNFSF5 ELISA Kit

Sign In for Pricing
View Details
CD2 (T-cell Surface Antigen CD2, Erythrocyte Receptor, LFA-2, LFA-3 Receptor, Rosette Receptor, T-cell Surface Antigen T11/Leu-5, SRBC, FLJ46032, T11) (FITC) discontinued
137659-FITC 100 µL

CD2 (T-cell Surface Antigen CD2, Erythrocyte Receptor, LFA-2, LFA-3 Receptor, Rosette Receptor, T-cell Surface Antigen T11/Leu-5, SRBC, FLJ46032, T11) (FITC) discontinued

Sign In for Pricing
View Details
NMNAT1 (NM_022787) Human Tagged ORF Clone Lentiviral Particle
RC204825L2V 200 µL

NMNAT1 (NM_022787) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Recombinant Streptococcus pneumoniae serotype 19F Segregation and condensation protein B (scpB)
MBS1033916-01 0.02 mg (E-Coli)

Recombinant Streptococcus pneumoniae serotype 19F Segregation and condensation protein B (scpB)

Sign In for Pricing
View Details
Recombinant Streptococcus pneumoniae serotype 19F Segregation and condensation protein B (scpB)
MBS1033916-02 0.1 mg (E-Coli)

Recombinant Streptococcus pneumoniae serotype 19F Segregation and condensation protein B (scpB)

Sign In for Pricing
View Details
Recombinant Streptococcus pneumoniae serotype 19F Segregation and condensation protein B (scpB)
MBS1033916-03 0.02 mg (Yeast)

Recombinant Streptococcus pneumoniae serotype 19F Segregation and condensation protein B (scpB)

Sign In for Pricing
View Details