Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human GDNF family receptor alpha-like (GFRAL), partial

Recombinant Human GDNF family receptor alpha-like (GFRAL), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: GFRAL. Target Synonyms: bA360D14.1; C6orf144; GDNF family receptor alpha-like; Gfral; GFRAL_HUMAN; GRAL; IVFI9356; UNQ9356; UNQ9356/PRO34128. Accession Number: Q6UXV0. Expression Region: 19~351aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 53.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human GDNF family receptor alpha-like (GFRAL), partial is a purified Recombinant Protein.

Accession Number

Q6UXV0

Expression Region

19~351aa

Host

E. coli

Target

GFRAL

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Sumo-Tagged

Field of Research

Cell Biology

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Extracellular Domain

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

53.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

BA360D14.1; C6orf144; GDNF family receptor alpha-like; Gfral; GFRAL_HUMAN; GRAL; IVFI9356; UNQ9356; UNQ9356/PRO34128

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

SQTNNCTYLREQCLRDANGCKHAWRVMEDACNDSDPGDPCKMRNSSYCNLSIQYLVESNFQFKECLCTDDFYCTVNKLLGKKCINKSDNVKEDKFKWNLTTRSHHGFKGMWSCLEVAEACVGDVVCNAQLASYLKACSANGNPCDLKQCQAAIRFFYQNIPFNIAQMLAFCDCAQSDIPCQQSKEALHSKTCAVNMVPPPTCLSVIRSCQNDELCRRHYRTFQSKCWQRVTRKCHEDENCISTLSKQDLTCSGSDDCKAAYIDILGTVLQVQCTCRTITQSEESLCKIFQHMLHRKSCFNYPTLSNVKGMALYTRKHANKITLTGFHSPFNGE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal Arginase 1/ARG1/liver Arginase Antibody (ARG1/8869R) [DyLight 680]
NBP3-24201FR 0.1 mL

Rabbit Monoclonal Arginase 1/ARG1/liver Arginase Antibody (ARG1/8869R) [DyLight 680]

Sign In for Pricing
View Details
Human Orosomucoid 1 Native
B2017023 1 mg

Human Orosomucoid 1 Native

Sign In for Pricing
View Details
MECP2 antibody (Ser80)
20R-2859 100 ul

MECP2 antibody (Ser80)

Sign In for Pricing
View Details
Cefmenoxime sodium
MBS5811493 Inquire

Cefmenoxime sodium

Sign In for Pricing
View Details
Protocadherin Gamma (pan) Antibody (ATTO594)
abx441057 100 µg

Protocadherin Gamma (pan) Antibody (ATTO594)

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli (strain UTI89/UPEC) CLPX Polyclonal Antibody
MBS7191808 Inquire

Rabbit anti-Escherichia coli (strain UTI89/UPEC) CLPX Polyclonal Antibody

Sign In for Pricing
View Details