Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human GDNF family receptor alpha-like (GFRAL), partial

Recombinant Human GDNF family receptor alpha-like (GFRAL), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: GFRAL. Target Synonyms: bA360D14.1; C6orf144; GDNF family receptor alpha-like; Gfral; GFRAL_HUMAN; GRAL; IVFI9356; UNQ9356; UNQ9356/PRO34128. Accession Number: Q6UXV0. Expression Region: 19~351aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 53.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human GDNF family receptor alpha-like (GFRAL), partial is a purified Recombinant Protein.

Accession Number

Q6UXV0

Expression Region

19~351aa

Host

E. coli

Target

GFRAL

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Sumo-Tagged

Field of Research

Cell Biology

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Extracellular Domain

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

53.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

BA360D14.1; C6orf144; GDNF family receptor alpha-like; Gfral; GFRAL_HUMAN; GRAL; IVFI9356; UNQ9356; UNQ9356/PRO34128

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

SQTNNCTYLREQCLRDANGCKHAWRVMEDACNDSDPGDPCKMRNSSYCNLSIQYLVESNFQFKECLCTDDFYCTVNKLLGKKCINKSDNVKEDKFKWNLTTRSHHGFKGMWSCLEVAEACVGDVVCNAQLASYLKACSANGNPCDLKQCQAAIRFFYQNIPFNIAQMLAFCDCAQSDIPCQQSKEALHSKTCAVNMVPPPTCLSVIRSCQNDELCRRHYRTFQSKCWQRVTRKCHEDENCISTLSKQDLTCSGSDDCKAAYIDILGTVLQVQCTCRTITQSEESLCKIFQHMLHRKSCFNYPTLSNVKGMALYTRKHANKITLTGFHSPFNGE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Signal Transducer And Activator of Transcription 4 (STAT4) Antibody
abx145694-01 100 µg

Signal Transducer And Activator of Transcription 4 (STAT4) Antibody

Sign In for Pricing
View Details
Signal Transducer And Activator of Transcription 4 (STAT4) Antibody
abx145694-02 1 mg

Signal Transducer And Activator of Transcription 4 (STAT4) Antibody

Sign In for Pricing
View Details
TRAV16 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV787799 1.0 µg DNA

TRAV16 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Mouse OLFML2B shRNA Plasmid
abx983348-01 150 µg

Mouse OLFML2B shRNA Plasmid

Sign In for Pricing
View Details
Mouse OLFML2B shRNA Plasmid
abx983348-02 300 µg

Mouse OLFML2B shRNA Plasmid

Sign In for Pricing
View Details
Mouse Far2 activation kit by CRISPRa
GA216823 1 Kit

Mouse Far2 activation kit by CRISPRa

Sign In for Pricing
View Details