Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human GDNF family receptor alpha-like (GFRAL), partial

Recombinant Human GDNF family receptor alpha-like (GFRAL), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: GFRAL. Target Synonyms: bA360D14.1; C6orf144; GDNF family receptor alpha-like; Gfral; GFRAL_HUMAN; GRAL; IVFI9356; UNQ9356; UNQ9356/PRO34128. Accession Number: Q6UXV0. Expression Region: 19~351aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 53.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human GDNF family receptor alpha-like (GFRAL), partial is a purified Recombinant Protein.

Accession Number

Q6UXV0

Expression Region

19~351aa

Host

E. coli

Target

GFRAL

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Sumo-Tagged

Field of Research

Cell Biology

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Extracellular Domain

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

53.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

BA360D14.1; C6orf144; GDNF family receptor alpha-like; Gfral; GFRAL_HUMAN; GRAL; IVFI9356; UNQ9356; UNQ9356/PRO34128

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

SQTNNCTYLREQCLRDANGCKHAWRVMEDACNDSDPGDPCKMRNSSYCNLSIQYLVESNFQFKECLCTDDFYCTVNKLLGKKCINKSDNVKEDKFKWNLTTRSHHGFKGMWSCLEVAEACVGDVVCNAQLASYLKACSANGNPCDLKQCQAAIRFFYQNIPFNIAQMLAFCDCAQSDIPCQQSKEALHSKTCAVNMVPPPTCLSVIRSCQNDELCRRHYRTFQSKCWQRVTRKCHEDENCISTLSKQDLTCSGSDDCKAAYIDILGTVLQVQCTCRTITQSEESLCKIFQHMLHRKSCFNYPTLSNVKGMALYTRKHANKITLTGFHSPFNGE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Hscb ELISA Kit
EF015291 96 Tests

Mouse Hscb ELISA Kit

Sign In for Pricing
View Details
Rabbit Polyclonal C9orf4 Antibody
NBP1-59961 100 µL

Rabbit Polyclonal C9orf4 Antibody

Sign In for Pricing
View Details
Gastrointestinalcancer Marker-CA199 Mouse ELISA Kit
20471 96 Tests

Gastrointestinalcancer Marker-CA199 Mouse ELISA Kit

Sign In for Pricing
View Details
Quick Step Mouse Elastin (ELN) elisa Kit
QS0748Mo-01 48 Tests

Quick Step Mouse Elastin (ELN) elisa Kit

Sign In for Pricing
View Details
Quick Step Mouse Elastin (ELN) elisa Kit
QS0748Mo-02 96 Tests

Quick Step Mouse Elastin (ELN) elisa Kit

Sign In for Pricing
View Details
Ift81 (NM_009879) Mouse Tagged Lenti ORF Clone
MR209962L4 10 µg

Ift81 (NM_009879) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details