Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse RNA polymerase II subunit A C-terminal domain phosphatase (Ctdp1), partial

Recombinant Mouse RNA polymerase II subunit A C-terminal domain phosphatase (Ctdp1), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Ctdp1. Target Synonyms: TFIIF-associating CTD phosphatase. Accession Number: Q7TSG2. Expression Region: 178~341aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 24kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Mouse RNA polymerase II subunit A C-terminal domain phosphatase (Ctdp1), partial is a purified Recombinant Protein.

Accession Number

Q7TSG2

Expression Region

178~341aa

Host

E. coli

Target

Ctdp1

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Field of Research

Signal Transduction

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

24kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

TFIIF-associating CTD phosphatase

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

HRNRKLVLMVDLDQTLIHTTEQHCPQMSNKGIFHFQLGRGEPMLHTRLRPHCKDFLEKIAKLYELHVFTFGSRLYAHTIAGFLDPEKKLFSHRILSRDECIDPFSKTGNLRNLFPCGDSMVCIIDDREDVWKFAPNLITVKKYVYFPGTGDVNAPPAARETQAR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

USP18-set siRNA/shRNA/RNAi Lentivector (Human)
49295091 4x 500 ng

USP18-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
RPS9P4 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV782718 1.0 µg DNA

RPS9P4 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
Aflatoxin B2
TRC-A357465-5MG 5 mg

Aflatoxin B2

Sign In for Pricing
View Details
Monkey Chromobox protein homolog 7 (CBX7) ELISA Kit
MBS7240126-01 48 Well

Monkey Chromobox protein homolog 7 (CBX7) ELISA Kit

Sign In for Pricing
View Details
Monkey Chromobox protein homolog 7 (CBX7) ELISA Kit
MBS7240126-02 96 Well

Monkey Chromobox protein homolog 7 (CBX7) ELISA Kit

Sign In for Pricing
View Details
Monkey Chromobox protein homolog 7 (CBX7) ELISA Kit
MBS7240126-03 5x 96 Well

Monkey Chromobox protein homolog 7 (CBX7) ELISA Kit

Sign In for Pricing
View Details