Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse RNA polymerase II subunit A C-terminal domain phosphatase (Ctdp1), partial

Recombinant Mouse RNA polymerase II subunit A C-terminal domain phosphatase (Ctdp1), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Ctdp1. Target Synonyms: TFIIF-associating CTD phosphatase. Accession Number: Q7TSG2. Expression Region: 178~341aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 24kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Mouse RNA polymerase II subunit A C-terminal domain phosphatase (Ctdp1), partial is a purified Recombinant Protein.

Accession Number

Q7TSG2

Expression Region

178~341aa

Host

E. coli

Target

Ctdp1

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Field of Research

Signal Transduction

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

24kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

TFIIF-associating CTD phosphatase

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

HRNRKLVLMVDLDQTLIHTTEQHCPQMSNKGIFHFQLGRGEPMLHTRLRPHCKDFLEKIAKLYELHVFTFGSRLYAHTIAGFLDPEKKLFSHRILSRDECIDPFSKTGNLRNLFPCGDSMVCIIDDREDVWKFAPNLITVKKYVYFPGTGDVNAPPAARETQAR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

HDAC2 Mouse Monoclonal Antibody [Clone ID: LBI7E10]
AMM18286VCF 100 µg

HDAC2 Mouse Monoclonal Antibody [Clone ID: LBI7E10]

Sign In for Pricing
View Details
Silver Metal Powder 99.9%
030072-01 25 g

Silver Metal Powder 99.9%

Sign In for Pricing
View Details
Silver Metal Powder 99.9%
030072-02 100 g

Silver Metal Powder 99.9%

Sign In for Pricing
View Details
Gm13124 (NM_001085542) Mouse Tagged Lenti ORF Clone
MR213038L4 10 µg

Gm13124 (NM_001085542) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Mouse Monoclonal Respiratory Syncytial Virus Glycoprotein F Antibody (11-2-F3) [mFluor Violet 610 SE]
NBP2-50412MFV610 0.1 mL

Mouse Monoclonal Respiratory Syncytial Virus Glycoprotein F Antibody (11-2-F3) [mFluor Violet 610 SE]

Sign In for Pricing
View Details
MCM6 Recombinant Antibody, APC-Cy5.5 Conjugated
bsm-62771R-APC-Cy5.5 100 µL

MCM6 Recombinant Antibody, APC-Cy5.5 Conjugated

Sign In for Pricing
View Details