Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse RNA polymerase II subunit A C-terminal domain phosphatase (Ctdp1), partial

Recombinant Mouse RNA polymerase II subunit A C-terminal domain phosphatase (Ctdp1), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Ctdp1. Target Synonyms: TFIIF-associating CTD phosphatase. Accession Number: Q7TSG2. Expression Region: 178~341aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 24kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Mouse RNA polymerase II subunit A C-terminal domain phosphatase (Ctdp1), partial is a purified Recombinant Protein.

Accession Number

Q7TSG2

Expression Region

178~341aa

Host

E. coli

Target

Ctdp1

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Field of Research

Signal Transduction

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

24kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

TFIIF-associating CTD phosphatase

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

HRNRKLVLMVDLDQTLIHTTEQHCPQMSNKGIFHFQLGRGEPMLHTRLRPHCKDFLEKIAKLYELHVFTFGSRLYAHTIAGFLDPEKKLFSHRILSRDECIDPFSKTGNLRNLFPCGDSMVCIIDDREDVWKFAPNLITVKKYVYFPGTGDVNAPPAARETQAR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MRM1 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV712393 1.0 µg DNA

MRM1 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Wbp7 3'UTR Luciferase Stable Cell Line
TU122195 1.0 mL

Wbp7 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Lentiviral mouse Rdh8 shRNA (UAS) - Lentiviral mouse Rdh8 shRNA (UAS, iRFP) plasmid
GTR15187456 1 Vial

Lentiviral mouse Rdh8 shRNA (UAS) - Lentiviral mouse Rdh8 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Lentiviral mouse Kcnmb2 shRNA (UAS) - Lentiviral mouse Kcnmb2 shRNA (UAS) plasmid
GTR15159559 1 Vial

Lentiviral mouse Kcnmb2 shRNA (UAS) - Lentiviral mouse Kcnmb2 shRNA (UAS) plasmid

Sign In for Pricing
View Details
Porcine interleukin 27 p28 (IL-27 p28) ELISA Kit
MBS2601812-01 48 Well

Porcine interleukin 27 p28 (IL-27 p28) ELISA Kit

Sign In for Pricing
View Details
Porcine interleukin 27 p28 (IL-27 p28) ELISA Kit
MBS2601812-02 96 Well

Porcine interleukin 27 p28 (IL-27 p28) ELISA Kit

Sign In for Pricing
View Details