Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Adiponectin (Adipoq)

Recombinant Mouse Adiponectin (Adipoq) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Adipoq. Target Synonyms: 30 kDa adipocyte complement-related protein; Adipocyte complement-related 30 kDa protein; ACRP30Adipocyte, C1q and collagen domain-containing protein; Adipocyte-specific protein AdipoQ. Accession Number: Q60994. Expression Region: 18~247aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 28.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Mouse Adiponectin (Adipoq) is a purified Recombinant Protein.

Accession Number

Q60994

Expression Region

18~247aa

Host

E. coli

Target

Adipoq

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

28.9kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

30 kDa adipocyte complement-related protein; Adipocyte complement-related 30 kDa protein; ACRP30Adipocyte, C1q and collagen domain-containing protein; Adipocyte-specific protein AdipoQ

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

EDDVTTTEELAPALVPPPKGTCAGWMAGIPGHPGHNGTPGRDGRDGTPGEKGEKGDAGLLGPKGETGDVGMTGAEGPRGFPGTPGRKGEPGEAAYVYRSAFSVGLETRVTVPNVPIRFTKIFYNQQNHYDGSTGKFYCNIPGLYYFSYHITVYMKDVKVSLFKKDKAVLFTYDQYQEKNVDQASGSVLLHLEVGDQVWLQVYGDGDHNGLYADNVNDSTFTGFLLYHDTN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Leucine Aminopeptidase (LAP) ELISA Kit
DLR-LAP-Hu-48T 48 Tests

Human Leucine Aminopeptidase (LAP) ELISA Kit

Sign In for Pricing
View Details
ODF3 Recombinant Protein (Rat)
RP215057 100 µg

ODF3 Recombinant Protein (Rat)

Sign In for Pricing
View Details
Langerin Antibody / CD207
V4881SAF-100UG 100 µg

Langerin Antibody / CD207

Sign In for Pricing
View Details
Human MT1G Pre-designed siRNA Set A
SI009944A 1 Each

Human MT1G Pre-designed siRNA Set A

Sign In for Pricing
View Details
3-bromo-1- (4-chlorophenyl) -2-phenyl-1H-pyrrole
JH920164 1 Each

3-bromo-1- (4-chlorophenyl) -2-phenyl-1H-pyrrole

Sign In for Pricing
View Details
Rabbit Polyclonal STK39 Antibody [mFluor Violet 500 SE]
NBP1-76957MFV500 0.1 mL

Rabbit Polyclonal STK39 Antibody [mFluor Violet 500 SE]

Sign In for Pricing
View Details