Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Adiponectin (Adipoq)

Recombinant Mouse Adiponectin (Adipoq) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Adipoq. Target Synonyms: 30 kDa adipocyte complement-related protein; Adipocyte complement-related 30 kDa protein; ACRP30Adipocyte, C1q and collagen domain-containing protein; Adipocyte-specific protein AdipoQ. Accession Number: Q60994. Expression Region: 18~247aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 28.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Mouse Adiponectin (Adipoq) is a purified Recombinant Protein.

Accession Number

Q60994

Expression Region

18~247aa

Host

E. coli

Target

Adipoq

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

28.9kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

30 kDa adipocyte complement-related protein; Adipocyte complement-related 30 kDa protein; ACRP30Adipocyte, C1q and collagen domain-containing protein; Adipocyte-specific protein AdipoQ

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

EDDVTTTEELAPALVPPPKGTCAGWMAGIPGHPGHNGTPGRDGRDGTPGEKGEKGDAGLLGPKGETGDVGMTGAEGPRGFPGTPGRKGEPGEAAYVYRSAFSVGLETRVTVPNVPIRFTKIFYNQQNHYDGSTGKFYCNIPGLYYFSYHITVYMKDVKVSLFKKDKAVLFTYDQYQEKNVDQASGSVLLHLEVGDQVWLQVYGDGDHNGLYADNVNDSTFTGFLLYHDTN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OS9 Protein Vector (Mouse) (pPM-C-His)
PV212625 500 ng

OS9 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Phosphomevalonate kinase PMVK Rabbit Polyclonal Antibody (Carrier-free)
orb3083835 100 µg

Phosphomevalonate kinase PMVK Rabbit Polyclonal Antibody (Carrier-free)

Sign In for Pricing
View Details
Canine Cytochrome b5 domain containing protein 1 (CYB5D1) ELISA Kit
GTR10324745 96 Well

Canine Cytochrome b5 domain containing protein 1 (CYB5D1) ELISA Kit

Sign In for Pricing
View Details
Toxoplasma gondii SAG1 (Biotin)
MBS6125257-01 0.1 mL

Toxoplasma gondii SAG1 (Biotin)

Sign In for Pricing
View Details
Toxoplasma gondii SAG1 (Biotin)
MBS6125257-02 5x 0.1 mL

Toxoplasma gondii SAG1 (Biotin)

Sign In for Pricing
View Details
Zzz3 3'UTR Lenti-reporter-Luc Vector
52003086 1.0 µg

Zzz3 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details