Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Colwellia psychrerythraea DNA polymerase IV (dinB)

Recombinant Colwellia psychrerythraea DNA polymerase IV (dinB) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Colwellia psychrerythraea (strain 34H / ATCC BAA-681) (Vibrio psychroerythus) . Target Name: dinB. Target Synonyms: dinB; CPS_1040DNA polymerase IV; Pol IV; EC 2.7.7.7. Accession Number: Q487H6. Expression Region: 1~352aa. Tag Info: Tag-Free. Theoretical MW: 39.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Colwellia psychrerythraea DNA polymerase IV (dinB) is a purified Recombinant Protein.

Accession Number

Q487H6

Expression Region

1~352aa

Host

E. coli

Target

DinB

Conjugation

Unconjugated

Tag

Tag-Free

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

39.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

DinB; CPS_1040DNA polymerase IV; Pol IV; EC 2.7.7.7

Species

Colwellia psychrerythraea (strain 34H / ATCC BAA-681) (Vibrio psychroerythus)

Protein Name

Recombinant Protein

AA Sequence

MGNQKKIIHIDMDCFYAAIEMRDFPEYQNIPLAVGGDGPRSVLCTSNYQARQFGVRSAMPAIKAKQLCPHLKIVHGRMDVYKETSKNIREIFSRYTDLIEPLSLDEAYLDVTDATMCQGSATLIAERIRADIFNELNLTASAGIAPNKFLAKIASDENKPNGQCVITPDKVANFVEQLSLKKIPGIGPKTFEKLNRHGYVTCADVRQSNIRALQNIVGKFANSLYLKSHGVDNRDLEVSRQRKSLAIETTLAHDISTQDECKLVIDSLYQKLLTRLAPHSNREIIRQGVKLKFTDFNQTTVETQSNECQQALFISLLSKAYSRSNKRGVRLVGLTLGFADSPGESQQLSLSL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Phosphoglycerate kinase 1, PGK1 ELISA Kit
MBS1605529-01 48 Well

Mouse Phosphoglycerate kinase 1, PGK1 ELISA Kit

Sign In for Pricing
View Details
Mouse Phosphoglycerate kinase 1, PGK1 ELISA Kit
MBS1605529-02 96 Well

Mouse Phosphoglycerate kinase 1, PGK1 ELISA Kit

Sign In for Pricing
View Details
Mouse Phosphoglycerate kinase 1, PGK1 ELISA Kit
MBS1605529-03 5x 96 Well

Mouse Phosphoglycerate kinase 1, PGK1 ELISA Kit

Sign In for Pricing
View Details
Mouse Phosphoglycerate kinase 1, PGK1 ELISA Kit
MBS1605529-04 10x 96 Well

Mouse Phosphoglycerate kinase 1, PGK1 ELISA Kit

Sign In for Pricing
View Details
SUMO1 (Small Ubiquitin-related Modifier 1, SUMO-1, Ubiquitin-like Protein SMT3C, SMT3 Homolog 3, Ubiquitin-homology Domain Protein PIC1, Ubiquitin-like Protein UBL1, GAP Modifying Protein 1, GMP1, Sentrin, SMT3C, SMT3H3, UBL1, OK/SW-cl.43) (MaxLight 405)
MBS6188350-01 0.1 mL

SUMO1 (Small Ubiquitin-related Modifier 1, SUMO-1, Ubiquitin-like Protein SMT3C, SMT3 Homolog 3, Ubiquitin-homology Domain Protein PIC1, Ubiquitin-like Protein UBL1, GAP Modifying Protein 1, GMP1, Sentrin, SMT3C, SMT3H3, UBL1, OK/SW-cl.43) (MaxLight 405)

Sign In for Pricing
View Details
SUMO1 (Small Ubiquitin-related Modifier 1, SUMO-1, Ubiquitin-like Protein SMT3C, SMT3 Homolog 3, Ubiquitin-homology Domain Protein PIC1, Ubiquitin-like Protein UBL1, GAP Modifying Protein 1, GMP1, Sentrin, SMT3C, SMT3H3, UBL1, OK/SW-cl.43) (MaxLight 405)
MBS6188350-02 5x 0.1 mL

SUMO1 (Small Ubiquitin-related Modifier 1, SUMO-1, Ubiquitin-like Protein SMT3C, SMT3 Homolog 3, Ubiquitin-homology Domain Protein PIC1, Ubiquitin-like Protein UBL1, GAP Modifying Protein 1, GMP1, Sentrin, SMT3C, SMT3H3, UBL1, OK/SW-cl.43) (MaxLight 405)

Sign In for Pricing
View Details