Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pig Beta-nerve growth factor (NGF)

Recombinant Pig Beta-nerve growth factor (NGF) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Pig (Sus scrofa; Porcine) . Target Name: NGF. Target Synonyms: Beta-NGF. Accession Number: Q29074. Expression Region: 110~229aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 29.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Pig Beta-nerve growth factor (NGF) is a purified Recombinant Protein.

Accession Number

Q29074

Expression Region

110~229aa

Host

E. coli

Target

NGF

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Sumo-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

29.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Beta-NGF

Species

Pig (Sus scrofa; Porcine)

Protein Name

Recombinant Protein

AA Sequence

SSSHPVFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAGRRA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Histone H2A.XS139ph antibody (rAb)(H2AX)(Clone RM224)
MBS389511-01 0.1 mg

Histone H2A.XS139ph antibody (rAb)(H2AX)(Clone RM224)

Sign In for Pricing
View Details
Histone H2A.XS139ph antibody (rAb)(H2AX)(Clone RM224)
MBS389511-02 5x 0.1 mg

Histone H2A.XS139ph antibody (rAb)(H2AX)(Clone RM224)

Sign In for Pricing
View Details
Mouse TGF-beta receptor type-1, TGFBR1 ELISA Kit
MBS1601028-01 48 Well

Mouse TGF-beta receptor type-1, TGFBR1 ELISA Kit

Sign In for Pricing
View Details
Mouse TGF-beta receptor type-1, TGFBR1 ELISA Kit
MBS1601028-02 96 Well

Mouse TGF-beta receptor type-1, TGFBR1 ELISA Kit

Sign In for Pricing
View Details
Mouse TGF-beta receptor type-1, TGFBR1 ELISA Kit
MBS1601028-03 5x 96 Well

Mouse TGF-beta receptor type-1, TGFBR1 ELISA Kit

Sign In for Pricing
View Details
Mouse TGF-beta receptor type-1, TGFBR1 ELISA Kit
MBS1601028-04 10x 96 Well

Mouse TGF-beta receptor type-1, TGFBR1 ELISA Kit

Sign In for Pricing
View Details