Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Microfibrillar-associated protein 5 (MFAP5)

Recombinant Human Microfibrillar-associated protein 5 (MFAP5) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: MFAP5. Target Synonyms: MP25Microfibril-associated glycoprotein 2; MAGP-2. Accession Number: Q13361. Expression Region: 22~173aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 33.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Microfibrillar-associated protein 5 (MFAP5) is a purified Recombinant Protein.

Accession Number

Q13361

Expression Region

22~173aa

Host

E. coli

Target

MFAP5

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Sumo-Tagged

Field of Research

Cancer

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

33.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

MP25Microfibril-associated glycoprotein 2; MAGP-2

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

IPLGVNSQRGDDVTQATPETFTEDPNLVNDPATDETVLAVLADIAPSTDDLASLSEKNTTAECWDEKFTCTRLYSVHRPVKQCIHQLCFTSLRRMYIVNKEICSRLVCKEHEAMKDELCRQMAGLPPRRLRRSNYFRLPPCENVDLQRPNGL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse IFNGR1 / CD119 Protein (Fc tag)
MBS2546838-01 0.1 mg

Recombinant Mouse IFNGR1 / CD119 Protein (Fc tag)

Sign In for Pricing
View Details
Recombinant Mouse IFNGR1 / CD119 Protein (Fc tag)
MBS2546838-02 5x 0.1 mg

Recombinant Mouse IFNGR1 / CD119 Protein (Fc tag)

Sign In for Pricing
View Details
Actin alpha 1 Antibody / ACTA1
V9696-100UG 100 µg

Actin alpha 1 Antibody / ACTA1

Sign In for Pricing
View Details
Mouse Monoclonal IL-23R Antibody (218213) [Alexa Fluor 350]
FAB14001U 0.1 mL

Mouse Monoclonal IL-23R Antibody (218213) [Alexa Fluor 350]

Sign In for Pricing
View Details
Trmt1 ORF Vector (Mouse) (pORF)
47864014 1.0 µg DNA

Trmt1 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Recombinant Haemophilus ducreyi Deoxyuridine 5'-triphosphate nucleotidohydrolase (dut)
MBS1317388-01 0.02 mg (E-Coli)

Recombinant Haemophilus ducreyi Deoxyuridine 5'-triphosphate nucleotidohydrolase (dut)

Sign In for Pricing
View Details