Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-15 receptor subunit alpha (IL15RA), partial

Recombinant Human Interleukin-15 receptor subunit alpha (IL15RA), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: IL15RA. Target Synonyms: CD_antigen: CD215. Accession Number: Q13261. Expression Region: 31~205aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 23.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Interleukin-15 receptor subunit alpha (IL15RA), partial is a purified Recombinant Protein.

Accession Number

Q13261

Expression Region

31~205aa

Host

E. coli

Target

IL15RA

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Field of Research

Cancer

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

23.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

CD_antigen: CD215

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

ITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIRDPALVHQRPAPPSTVTTAGVTPQPESLSPSGKEPAASSPSSNNTAATTAAIVPGSQLMPSKSPSTGTTEISSHESSHGTPSQTTAKNWELTASASHQPPGVYPQGHSDTT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human talin ELISA Kit
MBS164123-01 48 Well

Human talin ELISA Kit

Sign In for Pricing
View Details
Human talin ELISA Kit
MBS164123-02 96 Well

Human talin ELISA Kit

Sign In for Pricing
View Details
Human talin ELISA Kit
MBS164123-03 5x 96 Well

Human talin ELISA Kit

Sign In for Pricing
View Details
Human talin ELISA Kit
MBS164123-04 10x 96 Well

Human talin ELISA Kit

Sign In for Pricing
View Details
CXCR4 (C-X-C Chemokine Receptor Type 4, CD184, D2S201E, FB22, HM89, HSY3RR, LAP3, LCR1, LESTR, NPY3R, NPYR, NPYRL, NPYY3R, WHIM) (MaxLight 550)
MBS6215692-01 0.1 mL

CXCR4 (C-X-C Chemokine Receptor Type 4, CD184, D2S201E, FB22, HM89, HSY3RR, LAP3, LCR1, LESTR, NPY3R, NPYR, NPYRL, NPYY3R, WHIM) (MaxLight 550)

Sign In for Pricing
View Details
CXCR4 (C-X-C Chemokine Receptor Type 4, CD184, D2S201E, FB22, HM89, HSY3RR, LAP3, LCR1, LESTR, NPY3R, NPYR, NPYRL, NPYY3R, WHIM) (MaxLight 550)
MBS6215692-02 5x 0.1 mL

CXCR4 (C-X-C Chemokine Receptor Type 4, CD184, D2S201E, FB22, HM89, HSY3RR, LAP3, LCR1, LESTR, NPY3R, NPYR, NPYRL, NPYY3R, WHIM) (MaxLight 550)

Sign In for Pricing
View Details