Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Kynurenine--oxoglutarate transaminase 1 (KYAT1)

Recombinant Human Kynurenine--oxoglutarate transaminase 1 (KYAT1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: KYAT1. Target Synonyms: Cysteine-S-conjugate beta-lyase (EC:4.4.1.13) Glutamine transaminase K; GTKGlutamine--phenylpyruvate transaminase (EC:2.6.1.64) Kynurenine aminotransferase I; KATIKynurenine--oxoglutarate transaminase I. Accession Number: Q16773. Expression Region: 1~372aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 58.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Kynurenine--oxoglutarate transaminase 1 (KYAT1) is a purified Recombinant Protein.

Accession Number

Q16773

Expression Region

1~372aa

Host

E. coli

Target

KYAT1

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Sumo-Tagged

Field of Research

Metabolism

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Isoform 2

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

58.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Cysteine-S-conjugate beta-lyase (EC:4.4.1.13) Glutamine transaminase K; GTKGlutamine--phenylpyruvate transaminase (EC:2.6.1.64) Kynurenine aminotransferase I; KATIKynurenine--oxoglutarate transaminase I

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

MAKQLQARRLDGIDYNPWVEFVKLASEHDVVNLGQGFPDFPPPDFAVEAFQHAVSGDFMLNQYTKTFVIIIEPFFDCYEPMTMMAGGRPVFVSLKPGPIQNGELGSSSNWQLDPMELAGKFTSRTKALVLNTPNNPLGKVFSREELELVASLCQQHDVVCITDEVYQWMVYDGHQHISIASLPGMWERTLTIGSAGKTFSATGWKVGWVLGPDHIMKHLRTVHQNSVFHCPTQSQAAVAESFEREQLLFRQPSSYFVQFPQAMQRCRDHMIRSLQSVGLKPIIPQGSYFLITDISDFKRKMPDLPGAVDEPYDRRFVKWMIKNKGLVAIPVSIFYSVPHQKHFDHYIRFCFVKDEATLQAMDEKLRKWKVEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fibronectin (HFN7.1), CF568 conjugate, 0.1mg/mL
BNC680270-500 1x 500 µL

Fibronectin (HFN7.1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF680 conjugate, 0.1mg/mL
BNC800146-100 1x 100 µL

CD10 (CB-CALLA), CF680 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (158-2B3), CF647 conjugate, 0.1mg/mL
BNC470352-100 1x 100 µL

CD31 / PECAM-1 (158-2B3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (EGP40/1555R), CF647 conjugate, 0.1mg/mL
BNC471555-500 1x 500 µL

Ep-CAM / CD326 (Epithelial Marker) (EGP40/1555R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/1373), CF405S conjugate, 0.1mg/mL
BNC041373-100 1x 100 µL

Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/1373), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (323/A3), CF640R conjugate, 0.1mg/mL
BNC400396-500 1x 500 µL

Ep-CAM / CD326 (323/A3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details