Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant E. coli Translational regulator CsrA (csrA)

Recombinant E. coli Translational regulator CsrA (csrA) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: E. coli (strain K12 / DH10B) . Target Name: csrA. Target Synonyms: csrA; ECDH10B_2864; Translational regulator CsrA; Carbon storage regulator. Accession Number: B1XCM4. Expression Region: 1~61aa. Tag Info: Tag-Free. Theoretical MW: 6.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant E. coli Translational regulator CsrA (csrA) is a purified Recombinant Protein.

Accession Number

B1XCM4

Expression Region

1~61aa

Host

E. coli

Target

CsrA

Conjugation

Unconjugated

Tag

Tag-Free

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

6.9kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

CsrA; ECDH10B_2864; Translational regulator CsrA; Carbon storage regulator

Species

E. coli (strain K12 / DH10B)

Protein Name

Recombinant Protein

AA Sequence

MLILTRRVGETLMIGDEVTVTVLGVKGNQVRIGVNAPKEVSVHREEIYQRIQAEKSQQSSY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HOMER1 Antibody
orb1242261 100 µL

HOMER1 Antibody

Sign In for Pricing
View Details
Human von Willebrand Factor, vWF ELISA Kit
YLA1741HU-01 48 Tests

Human von Willebrand Factor, vWF ELISA Kit

Sign In for Pricing
View Details
Human von Willebrand Factor, vWF ELISA Kit
YLA1741HU-02 96 Tests

Human von Willebrand Factor, vWF ELISA Kit

Sign In for Pricing
View Details
Zic5 Double Nickase Plasmid (m2)
sc-425750-NIC-2 20 µg

Zic5 Double Nickase Plasmid (m2)

Sign In for Pricing
View Details
Rabbit Monoclonal Cytokeratin, pan Antibody (MonoPoly/7249R) [mFluor Violet 450 SE]
NBP3-14199MFV450 0.1 mL

Rabbit Monoclonal Cytokeratin, pan Antibody (MonoPoly/7249R) [mFluor Violet 450 SE]

Sign In for Pricing
View Details
Kcnh1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
25359116 3x 1.0 µg

Kcnh1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details