Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant E. coli Translational regulator CsrA (csrA)

Recombinant E. coli Translational regulator CsrA (csrA) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: E. coli (strain K12 / DH10B) . Target Name: csrA. Target Synonyms: csrA; ECDH10B_2864; Translational regulator CsrA; Carbon storage regulator. Accession Number: B1XCM4. Expression Region: 1~61aa. Tag Info: Tag-Free. Theoretical MW: 6.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant E. coli Translational regulator CsrA (csrA) is a purified Recombinant Protein.

Accession Number

B1XCM4

Expression Region

1~61aa

Host

E. coli

Target

CsrA

Conjugation

Unconjugated

Tag

Tag-Free

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

6.9kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

CsrA; ECDH10B_2864; Translational regulator CsrA; Carbon storage regulator

Species

E. coli (strain K12 / DH10B)

Protein Name

Recombinant Protein

AA Sequence

MLILTRRVGETLMIGDEVTVTVLGVKGNQVRIGVNAPKEVSVHREEIYQRIQAEKSQQSSY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPP6C Protein Lysate (Human) with C-Ha Tag
37499031 100 µg

PPP6C Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
3- (4-Boronophenyl) propanoic acid
orb3175437-01 10 mg

3- (4-Boronophenyl) propanoic acid

Sign In for Pricing
View Details
3- (4-Boronophenyl) propanoic acid
orb3175437-02 50 mg

3- (4-Boronophenyl) propanoic acid

Sign In for Pricing
View Details
KRT8P19 CRISPR Knock Out 293T Cell Line (Human)
26067141 1x 10^6 Cells / 1.0 mL

KRT8P19 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
KLC1 Recombinant Antibody, Cy7 Conjugated
bsm-62372R-Cy7-TR 20 µL

KLC1 Recombinant Antibody, Cy7 Conjugated

Sign In for Pricing
View Details
Trappc6b 3'UTR Luciferase Stable Cell Line
TU121045 1.0 mL

Trappc6b 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details