Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant E. coli S-ribosylhomocysteine lyase (luxS)

Recombinant E. coli S-ribosylhomocysteine lyase (luxS) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: E. coli (strain K12) . Target Name: luxS. Target Synonyms: AI-2 synthesis protein; Autoinducer-2 production protein LuxS. Accession Number: P45578. Expression Region: 2~171aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 23.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant E. coli S-ribosylhomocysteine lyase (luxS) is a purified Recombinant Protein.

Accession Number

P45578

Expression Region

2~171aa

Host

E. coli

Target

LuxS

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

23.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

AI-2 synthesis protein; Autoinducer-2 production protein LuxS

Species

E. coli (strain K12)

Protein Name

Recombinant Protein

AA Sequence

PLLDSFTVDHTRMEAPAVRVAKTMNTPHGDAITVFDLRFCVPNKEVMPERGIHTLEHLFAGFMRNHLNGNGVEIIDISPMGCRTGFYMSLIGTPDEQRVADAWKAAMEDVLKVQDQNQIPELNVYQCGTYQMHSLQEAQDIARSILERDVRINSNEELALPKEKLQELHI

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polyclonal PACE4 Antibody (internal region)
APG00565G 0.1mg

Polyclonal PACE4 Antibody (internal region)

Sign In for Pricing
View Details
Rat Epb41l3 Pre-designed siRNA Set B
SI204483B 1 Each

Rat Epb41l3 Pre-designed siRNA Set B

Sign In for Pricing
View Details
CNIH, CT (CNIH, CNIL, Protein cornichon homolog, T-cell growth-associated molecule 77) (Azide free) (HRP)
MBS6287178-01 0.2 mL

CNIH, CT (CNIH, CNIL, Protein cornichon homolog, T-cell growth-associated molecule 77) (Azide free) (HRP)

Sign In for Pricing
View Details
CNIH, CT (CNIH, CNIL, Protein cornichon homolog, T-cell growth-associated molecule 77) (Azide free) (HRP)
MBS6287178-02 5x 0.2 mL

CNIH, CT (CNIH, CNIL, Protein cornichon homolog, T-cell growth-associated molecule 77) (Azide free) (HRP)

Sign In for Pricing
View Details
Rabbit Polyclonal Aconitase 1 Antibody
NBP1-87677 0.1 mL

Rabbit Polyclonal Aconitase 1 Antibody

Sign In for Pricing
View Details
Bovine Density-regulated protein, DENR ELISA KIT
ELI-26356b 96 Tests

Bovine Density-regulated protein, DENR ELISA KIT

Sign In for Pricing
View Details