Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant E. coli S-ribosylhomocysteine lyase (luxS)

Recombinant E. coli S-ribosylhomocysteine lyase (luxS) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: E. coli (strain K12) . Target Name: luxS. Target Synonyms: AI-2 synthesis protein; Autoinducer-2 production protein LuxS. Accession Number: P45578. Expression Region: 2~171aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 23.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant E. coli S-ribosylhomocysteine lyase (luxS) is a purified Recombinant Protein.

Accession Number

P45578

Expression Region

2~171aa

Host

E. coli

Target

LuxS

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

23.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

AI-2 synthesis protein; Autoinducer-2 production protein LuxS

Species

E. coli (strain K12)

Protein Name

Recombinant Protein

AA Sequence

PLLDSFTVDHTRMEAPAVRVAKTMNTPHGDAITVFDLRFCVPNKEVMPERGIHTLEHLFAGFMRNHLNGNGVEIIDISPMGCRTGFYMSLIGTPDEQRVADAWKAAMEDVLKVQDQNQIPELNVYQCGTYQMHSLQEAQDIARSILERDVRINSNEELALPKEKLQELHI

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal ATP2C1 Antibody [Alexa Fluor 488]
NBP1-76566AF488 0.1 mL

Rabbit Polyclonal ATP2C1 Antibody [Alexa Fluor 488]

Sign In for Pricing
View Details
HRP Conjugated Glycine max Lectin (Soybean) -SBA-
H-1301-2 2 mg

HRP Conjugated Glycine max Lectin (Soybean) -SBA-

Sign In for Pricing
View Details
CD106 (CD106 Antigen, DKFZp779G2333, INCAM 100, INCAM-100, L1CAM, MGC99561, Vascular Cell Adhesion Molecule 1, VCAM 1, VCAM1, VCAM-1, Vascular Cell Adhesion Protein 1)
124512 100 µg

CD106 (CD106 Antigen, DKFZp779G2333, INCAM 100, INCAM-100, L1CAM, MGC99561, Vascular Cell Adhesion Molecule 1, VCAM 1, VCAM1, VCAM-1, Vascular Cell Adhesion Protein 1)

Sign In for Pricing
View Details
Fgf7 (NM_008008) Mouse Tagged ORF Clone Lentiviral Particle
MR201882L4V 200 µL

Fgf7 (NM_008008) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
ZFPM2 (Zinc Finger Protein ZFPM2, Zinc Finger Protein, FOG Family Member 2)
496048 100 µL

ZFPM2 (Zinc Finger Protein ZFPM2, Zinc Finger Protein, FOG Family Member 2)

Sign In for Pricing
View Details
Recombinant Bacillus cereus ATP synthase subunit c (atpE), partial
MBS7068564 Inquire

Recombinant Bacillus cereus ATP synthase subunit c (atpE), partial

Sign In for Pricing
View Details