Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant E. coli S-ribosylhomocysteine lyase (luxS)

Recombinant E. coli S-ribosylhomocysteine lyase (luxS) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: E. coli (strain K12) . Target Name: luxS. Target Synonyms: AI-2 synthesis protein; Autoinducer-2 production protein LuxS. Accession Number: P45578. Expression Region: 2~171aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 23.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant E. coli S-ribosylhomocysteine lyase (luxS) is a purified Recombinant Protein.

Accession Number

P45578

Expression Region

2~171aa

Host

E. coli

Target

LuxS

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

23.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

AI-2 synthesis protein; Autoinducer-2 production protein LuxS

Species

E. coli (strain K12)

Protein Name

Recombinant Protein

AA Sequence

PLLDSFTVDHTRMEAPAVRVAKTMNTPHGDAITVFDLRFCVPNKEVMPERGIHTLEHLFAGFMRNHLNGNGVEIIDISPMGCRTGFYMSLIGTPDEQRVADAWKAAMEDVLKVQDQNQIPELNVYQCGTYQMHSLQEAQDIARSILERDVRINSNEELALPKEKLQELHI

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Arabidopsis thaliana 3-ketoacyl-CoA synthase 8 (KCS8) , partial
MBS7083124 Inquire

Recombinant Arabidopsis thaliana 3-ketoacyl-CoA synthase 8 (KCS8) , partial

Sign In for Pricing
View Details
H2 (H2-Eb2) (NM_001033978) Mouse Tagged ORF Clone Lentiviral Particle
MR219610L4V 200 µL

H2 (H2-Eb2) (NM_001033978) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Rat Metallothionein-1F (MT1F) ELISA Kit
MBS2606744-01 48 Well

Rat Metallothionein-1F (MT1F) ELISA Kit

Sign In for Pricing
View Details
Rat Metallothionein-1F (MT1F) ELISA Kit
MBS2606744-02 96 Well

Rat Metallothionein-1F (MT1F) ELISA Kit

Sign In for Pricing
View Details
Rat Metallothionein-1F (MT1F) ELISA Kit
MBS2606744-03 5x 96 Well

Rat Metallothionein-1F (MT1F) ELISA Kit

Sign In for Pricing
View Details
Rat Metallothionein-1F (MT1F) ELISA Kit
MBS2606744-04 10x 96 Well

Rat Metallothionein-1F (MT1F) ELISA Kit

Sign In for Pricing
View Details