Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Porcine circovirus 2 Capsid protein (Cap)

Recombinant Porcine circovirus 2 Capsid protein (Cap) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Porcine circovirus 2 (PCV2) . Target Name: Cap. Target Synonyms: Cap; ORF2Capsid protein. Accession Number: O56129. Expression Region: 1~233aa. Tag Info: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 47.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Porcine circovirus 2 Capsid protein (Cap) is a purified Recombinant Protein.

Accession Number

O56129

Expression Region

1~233aa

Host

E. coli

Target

Cap

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged

Field of Research

Signal Transduction

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

47.9kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Cap; ORF2Capsid protein

Species

Porcine circovirus 2 (PCV2)

Protein Name

Recombinant Protein

AA Sequence

MTYPRRRYRRRRHRPRSHLGQILRRRPWLVHPRHRYRWRRKNGIFNTRLSRTFGYTVKATTVRTPSWAVDMMRFNIDDFVPPGGGTNKISIPFEYYRIRKVKVEFWPCSPITQGDRGVGSTAVILDDNFVTKATALTYDPYVNYSSRHTIPQPFSYHSRYFTPKPVLDSTIDYFQPNNKRTQLWLRLQTSRNVDHVGLGTAFENSIYDQDYNIRVTMYVQFREFNLKDPPLKP

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rat Macrophage Inflammatory Protein-1α (MIP-1α) Elisa Kit
EK721074 96 Well

Rat Macrophage Inflammatory Protein-1α (MIP-1α) Elisa Kit

Ask
View Details
VEGF-R1 (Fms like tyrosine kinase 1 (Flt-1), Fms-like tyrosine kinase 1, FRT, Tyrosine protein kinase FRT, Tyrosine protein kinase receptor FLT, Vascular endothelial growth factor receptor 1 (VEGFR1), Vascular permeability factor receptor 1) (FITC)
MBS6123799-01 0.1 mL

VEGF-R1 (Fms like tyrosine kinase 1 (Flt-1), Fms-like tyrosine kinase 1, FRT, Tyrosine protein kinase FRT, Tyrosine protein kinase receptor FLT, Vascular endothelial growth factor receptor 1 (VEGFR1), Vascular permeability factor receptor 1) (FITC)

Ask
View Details
VEGF-R1 (Fms like tyrosine kinase 1 (Flt-1), Fms-like tyrosine kinase 1, FRT, Tyrosine protein kinase FRT, Tyrosine protein kinase receptor FLT, Vascular endothelial growth factor receptor 1 (VEGFR1), Vascular permeability factor receptor 1) (FITC)
MBS6123799-02 5x 0.1 mL

VEGF-R1 (Fms like tyrosine kinase 1 (Flt-1), Fms-like tyrosine kinase 1, FRT, Tyrosine protein kinase FRT, Tyrosine protein kinase receptor FLT, Vascular endothelial growth factor receptor 1 (VEGFR1), Vascular permeability factor receptor 1) (FITC)

Ask
View Details
Cathelicidin Antimicrobial Peptide (CAMP) BioAssayTM ELISA Kit (Rat)
517077 96 Tests

Cathelicidin Antimicrobial Peptide (CAMP) BioAssayTM ELISA Kit (Rat)

Ask
View Details
Brilliant Violet 650™ anti-human CD45
GT07897 100 Tests

Brilliant Violet 650™ anti-human CD45

Ask
View Details
Monkey Myosin light chain kinase, smooth muscle (MYLK) ELISA Kit
MBS7210124-01 48 Well

Monkey Myosin light chain kinase, smooth muscle (MYLK) ELISA Kit

Ask
View Details