Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus thuringiensis subsp. Pesticidal crystal protein cry1Fb (cry1Fb), partial

Recombinant Bacillus thuringiensis subsp. Pesticidal crystal protein cry1Fb (cry1Fb), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Bacillus thuringiensis subsp. Morrisoni. Target Name: cry1Fb. Target Synonyms: 132 kDa crystal proteinCrystaline entomocidal protoxinInsecticidal delta-endotoxin CryIF (b) cryIF (b), cryINA67-1. Accession Number: O66377. Expression Region: 984~1169aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 26.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Bacillus thuringiensis subsp. Pesticidal crystal protein cry1Fb (cry1Fb), partial is a purified Recombinant Protein.

Accession Number

O66377

Expression Region

984~1169aa

Host

E. coli

Target

Cry1Fb

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

26.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

132 kDa crystal proteinCrystaline entomocidal protoxinInsecticidal delta-endotoxin CryIF (b) cryIF (b), cryINA67-1

Species

Bacillus thuringiensis subsp. Morrisoni

Protein Name

Recombinant Protein

AA Sequence

VKGHVDVEEQNNHRSVLVVPEWEAEVSQEVRVCPGRGYILRVTAYKEGYGEGCVTIHEVDNNTDELKFSSNCEKEQVYPGNTVACNDYNKNHGANACSSRNGGYDESYESNSSIPADYAPVYEEEAYTDGQRGNPCEFNRGHTPLPAGYVTAELEYFPETDTVWVEIGETEGTFIVDSVELLLMEE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal TFEB Antibody [HRP]
NBP2-12758H 100 µL

Rabbit Polyclonal TFEB Antibody [HRP]

Sign In for Pricing
View Details
Rat Omentin ELISA Kit
MBS267320-01 48 Well

Rat Omentin ELISA Kit

Sign In for Pricing
View Details
Rat Omentin ELISA Kit
MBS267320-02 96 Well

Rat Omentin ELISA Kit

Sign In for Pricing
View Details
Rat Omentin ELISA Kit
MBS267320-03 5x 96 Well

Rat Omentin ELISA Kit

Sign In for Pricing
View Details
Rat Omentin ELISA Kit
MBS267320-04 10x 96 Well

Rat Omentin ELISA Kit

Sign In for Pricing
View Details
MS4A13 (NM_001100909) Human Untagged Clone
SC316644 10 µg

MS4A13 (NM_001100909) Human Untagged Clone

Sign In for Pricing
View Details