Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Hepatitis B virus genotype D Protein X (X)

Recombinant Hepatitis B virus genotype D Protein X (X) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Hepatitis B virus genotype D (isolate Germany/1-91/1991) (HBV-D) . Target Name: X. Target Synonyms: HBxPeptide XpX. Accession Number: O93195. Expression Region: 1~154aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 32.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Hepatitis B virus genotype D Protein X (X) is a purified Recombinant Protein.

Accession Number

O93195

Expression Region

1~154aa

Host

E. coli

Target

X

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Sumo-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

32.7kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

HBxPeptide XpX

Species

Hepatitis B virus genotype D (isolate Germany/1-91/1991) (HBV-D)

Protein Name

Recombinant Protein

AA Sequence

MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQFLPKVLYKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

pLV3-CMV-ANXA2P2-ncRNA-Puro Plasmid
PVT47423 2 µg

pLV3-CMV-ANXA2P2-ncRNA-Puro Plasmid

Sign In for Pricing
View Details
Monkey cluster Of differentiation 82 (CD82) ELISA kit
GTR10409716 96 Well

Monkey cluster Of differentiation 82 (CD82) ELISA kit

Sign In for Pricing
View Details
ITM2A (NM_004867) Human Recombinant Protein
TP762181 50 µg

ITM2A (NM_004867) Human Recombinant Protein

Sign In for Pricing
View Details
Neuroligin 3 Antibody: ATTO 390
MBS801043-01 0.1 mg

Neuroligin 3 Antibody: ATTO 390

Sign In for Pricing
View Details
Neuroligin 3 Antibody: ATTO 390
MBS801043-02 5x 0.1 mg

Neuroligin 3 Antibody: ATTO 390

Sign In for Pricing
View Details
2-[4-Amino-3- (trifluoromethyl) -1H-pyrazol-1-yl]butanoic acid
WWB20311-01 50 mg

2-[4-Amino-3- (trifluoromethyl) -1H-pyrazol-1-yl]butanoic acid

Sign In for Pricing
View Details